BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B11 (432 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191 50 1e-06 03_05_0610 - 26108546-26108671,26108739-26108789,26109410-261095... 48 3e-06 >03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191 Length = 82 Score = 49.6 bits (113), Expect = 1e-06 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = +1 Query: 76 PRXCSASNRLIHAKDHASVQLVIADVXPATGRAADTSKMYVVCGAIRRMGESDDCIVRLT 255 PR CSA+NR+I AKDHASVQ+ I V G + + G IR G++D + RL Sbjct: 14 PRKCSATNRIITAKDHASVQINIGHV-DENGLYDGRFTTFALSGFIRAQGDADSALDRLW 72 Query: 256 KK 261 +K Sbjct: 73 QK 74 >03_05_0610 - 26108546-26108671,26108739-26108789,26109410-26109542, 26109633-26109682 Length = 119 Score = 48.0 bits (109), Expect = 3e-06 Identities = 26/62 (41%), Positives = 35/62 (56%) Frame = +1 Query: 76 PRXCSASNRLIHAKDHASVQLVIADVXPATGRAADTSKMYVVCGAIRRMGESDDCIVRLT 255 PR CS +NR+I AKDHASVQ+ I V G + + G IR G++D + RL Sbjct: 14 PRKCSTTNRIITAKDHASVQINIGHV-DENGLYDGRFTTFALSGFIRAQGDADSALDRLW 72 Query: 256 KK 261 +K Sbjct: 73 QK 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,656,841 Number of Sequences: 37544 Number of extensions: 164426 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -