BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B11 (432 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal prot... 88 3e-18 Z92967-1|CAB07477.1| 220|Caenorhabditis elegans Hypothetical pr... 27 5.8 >U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal protein, small subunitprotein 21 protein. Length = 88 Score = 87.8 bits (208), Expect = 3e-18 Identities = 41/70 (58%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = +1 Query: 76 PRXCSASNRLIHAKDHASVQLVIADVXPATGRAAD-TSKMYVVCGAIRRMGESDDCIVRL 252 PR CS+SNR+I KDHASVQ+ DV P TGR S Y +CGAIRRMGESDD I+RL Sbjct: 14 PRKCSSSNRIIGPKDHASVQIDFVDVDPETGRMIPGKSTRYAICGAIRRMGESDDAILRL 73 Query: 253 TKKDGILAKN 282 +KDG++ ++ Sbjct: 74 AQKDGLVPRD 83 >Z92967-1|CAB07477.1| 220|Caenorhabditis elegans Hypothetical protein T25E12.4b protein. Length = 220 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 151 VXPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDG 267 V + G + +S + A R +G + DC+V +TK++G Sbjct: 123 VADSEGAGSYSSFSSIASTASRMLGRAADCLVLMTKRNG 161 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,677,464 Number of Sequences: 27780 Number of extensions: 127980 Number of successful extensions: 291 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 724655464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -