BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B10 (542 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.09 |tim21||mitochondrial inner membrane presequence tra... 29 0.44 SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyc... 27 1.4 SPCC576.17c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 4.1 SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p... 25 5.5 SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S... 25 7.2 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 25 7.2 SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|... 25 9.5 >SPBC1289.09 |tim21||mitochondrial inner membrane presequence translocase complex subunit Tim21 |Schizosaccharomyces pombe|chr 2|||Manual Length = 223 Score = 29.1 bits (62), Expect = 0.44 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 134 GMISHQLLGRCQKEEARYMDCLEAYGLERGKVKCAHLFGDY 256 G+I + L+ K EA Y D EA+ L + +C ++FGD+ Sbjct: 84 GLIIYALVTSIWKGEAHYGD--EAFELLKANEECRYVFGDH 122 >SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyces pombe|chr 1|||Manual Length = 721 Score = 27.5 bits (58), Expect = 1.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 180 ASSFWQRPRSWWEIMPPVTSVN 115 A++ W ++WW+I PP+ VN Sbjct: 203 AAAIWATGQTWWQI-PPIARVN 223 >SPCC576.17c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 525 Score = 25.8 bits (54), Expect = 4.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 372 RGLTYFSSPVSFP*EICLCLSCLIAKNLLSCLV 274 R L Y S + + +C C+SC +A+N ++ Sbjct: 146 RKLVYIGSLIIY---VCFCISCALARNYAQLVI 175 >SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.4 bits (53), Expect = 5.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 168 WQRPRSWWEIMPP 130 W+R RS W+I PP Sbjct: 128 WKRKRSLWDIKPP 140 >SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2337 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +2 Query: 206 YGLERGKVKCAHLFGDYHECSTLTKQLKRFLAIRHERQRQIS 331 + + GK++C H G++ S L ++ ++ H+ +R I+ Sbjct: 1324 FEITMGKLRCLHALGEWDRLSQLAQE--NWIHAGHDARRYIA 1363 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 25.0 bits (52), Expect = 7.2 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 112 TVYGCYWWH----DFPPTSGSLPERGSQIHGLSRSLWFGTRKGQV 234 TV G WH D TS S R +WFGTR G + Sbjct: 486 TVTGLCHWHMPLGDTKVTSLSFKSSPENYSDDGRFVWFGTRDGML 530 >SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 241 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 115 VYGCYWWHDFPPTSGSLPERGSQIHGLSR 201 V C W D P +G E+GS + ++R Sbjct: 213 VQDCAMWPDGYPGTGRESEKGSNLEAITR 241 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,866,712 Number of Sequences: 5004 Number of extensions: 37031 Number of successful extensions: 92 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -