BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B10 (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 28 4.3 SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) 28 5.7 SB_48714| Best HMM Match : TrmB (HMM E-Value=0.71) 27 7.5 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_56123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +2 Query: 176 EARYMDCLEAYGL----ERGKVKCAHLFGDYHEC 265 +A Y DCL +YGL +R V C +LF C Sbjct: 800 QANYQDCLASYGLQSLKDRRGVFCLNLFSSISTC 833 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 122 DVTGGMISHQLLGRCQKEEARYMDCLEAYGLERGKVK 232 DV M+ HQL + Y CLE Y +E GK K Sbjct: 283 DVPWNMLRHQLAYVAPDGKVDYRSCLEQYAIE-GKTK 318 >SB_53796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +2 Query: 191 DCLEAYGLERGKVKCAHLFGDYHECSTLTKQLKRFLAIRHERQRQISQGKLTGD 352 DC + + GKV+CAH Y C+ K+ I + +G+ GD Sbjct: 362 DCSTCFCKKNGKVECAHQMCGYPVCANPIKETGHCCPICRDEIVDEGRGEDGGD 415 >SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = +2 Query: 176 EARYMDCLEAYGLE-----RGKVKCAHLFGDYHEC 265 +A Y DCL +YGL+ RG++ C +LF C Sbjct: 726 QANYQDCLASYGLQSLKDRRGEL-CLNLFSSISTC 759 >SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) Length = 2581 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 249 AITMNAQLLPNNLRDFWQ*DTRGRDKFLKENLQATKSM*APVWT 380 A+ +NA ++ + W +RG ++ K N+ A VWT Sbjct: 1922 ALKINATVMNKTVEAMWSYLSRGEQRYAKFNVSAMNKTIEAVWT 1965 >SB_48714| Best HMM Match : TrmB (HMM E-Value=0.71) Length = 199 Score = 27.5 bits (58), Expect = 7.5 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 67 VKLRKHHVFVAVLSLTVYGCY-WWHDFPPTSGSLPERG 177 V+ RK+ V VL L + WW D TSG L E G Sbjct: 59 VETRKYQVVNEVLWLDYFTAQIWWIDLDLTSGKLLETG 96 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 251 RRTNERT*PFLVPNHKLLDNPCIWLPLSGS 162 RR +RT P + +H LD P WL G+ Sbjct: 34 RRRTDRTDPTRILDHYALDPPTHWLVFQGA 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,965,265 Number of Sequences: 59808 Number of extensions: 270713 Number of successful extensions: 596 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -