BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B08 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0832 - 6500139-6500333,6500610-6500875,6501494-6501815,650... 27 8.9 >01_01_0832 - 6500139-6500333,6500610-6500875,6501494-6501815, 6501915-6502156,6502229-6502457,6503020-6503184, 6503279-6503605,6504150-6504191,6504333-6504400, 6504748-6504934,6506249-6506311,6506748-6506790, 6506919-6507019,6507110-6507184,6507359-6507445, 6507593-6507682,6507906-6507992,6508585-6508783, 6509113-6509177,6509502-6509606,6509726-6509871, 6510100-6510224,6510335-6510437,6510482-6510596, 6510734-6510869,6511298-6511387,6511484-6511578, 6511698-6511763,6511868-6511936,6512034-6512147, 6512241-6512448,6512545-6512600,6512818-6513552 Length = 1671 Score = 27.5 bits (58), Expect = 8.9 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 2/81 (2%) Frame = -1 Query: 525 LGDFNSHHTSWGSSVSNSYGYELLDILDMYS--LCILNSGSPTRLTKPGEVISAIDLSIC 352 LG+F+ GSS+S + ++I+ + + ++GSPT+ + P V+ +L++ Sbjct: 1330 LGEFDDLLDGNGSSLSKPDNIDGINIIFKSTGPTVLSSNGSPTQ-SNPSMVLEICNLTLL 1388 Query: 351 TPQLASSLSWSTLCSTYNSDH 289 TP+ + L DH Sbjct: 1389 TPRSGNILITDLTMELKEKDH 1409 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,799,903 Number of Sequences: 37544 Number of extensions: 242383 Number of successful extensions: 437 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -