BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B08 (612 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035350-1|AAH35350.1| 524|Homo sapiens cytochrome P450, family... 30 7.4 AC004523-1|AAC11543.1| 458|Homo sapiens F22329_1 protein. 30 7.4 >BC035350-1|AAH35350.1| 524|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 12 protein. Length = 524 Score = 29.9 bits (64), Expect = 7.4 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -1 Query: 576 FNEIKNLISVLPRPFMILGDFNSHHTSWGSSVSNSYGYELLDILDMYSLCILNSGSPTRL 397 FN +K+ I++ + I+ D H S GSS + + + L LD CI + S + Sbjct: 157 FNILKSYITIFNKSANIMLDKWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQ- 215 Query: 396 TKPGEVISAI 367 +P E I+ I Sbjct: 216 ERPSEYIATI 225 >AC004523-1|AAC11543.1| 458|Homo sapiens F22329_1 protein. Length = 458 Score = 29.9 bits (64), Expect = 7.4 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -1 Query: 576 FNEIKNLISVLPRPFMILGDFNSHHTSWGSSVSNSYGYELLDILDMYSLCILNSGSPTRL 397 FN +K+ I++ + I+ D H S GSS + + + L LD CI + S + Sbjct: 91 FNILKSYITIFNKSANIMLDKWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQ- 149 Query: 396 TKPGEVISAI 367 +P E I+ I Sbjct: 150 ERPSEYIATI 159 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,920,470 Number of Sequences: 237096 Number of extensions: 1460522 Number of successful extensions: 2007 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2007 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -