BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B08 (612 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical ... 56 2e-08 >AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical protein R11E3.3 protein. Length = 931 Score = 56.0 bits (129), Expect = 2e-08 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 2/86 (2%) Frame = -1 Query: 531 MILGDFNSHHTSWGSSVS-NSYGYELLDILDMY-SLCILNSGSPTRLTKPGEVISAIDLS 358 +I GD N+HH++W S S ++ G EL +++D++ L I N TR IS+ D++ Sbjct: 35 IISGDVNAHHSAWHSEGSEDTRGRELAELIDLHPDLIIQNEQVHTRADTYS--ISSPDIT 92 Query: 357 ICTPQLASSLSWSTLCSTYNSDHYPI 280 ICT LA+ WSTL SDH P+ Sbjct: 93 ICTADLATKCHWSTLYK-LGSDHIPM 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,947,903 Number of Sequences: 27780 Number of extensions: 223230 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -