BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B07 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 4.5 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 4.5 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 6.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 7.9 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.9 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -2 Query: 575 AFTLIIAILVAWNSVAAAFHKCAFALKVVIIV*LKSNFIC 456 AF L ++I V + + +FH+ +K+V++ +++ C Sbjct: 38 AFFLALSIGVVVSIYSKSFHRNEIHIKIVLMFFKEASLYC 77 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 288 KHLSQFINIVYIPYP 332 K++S+FIN+V YP Sbjct: 297 KNISEFINVVLNNYP 311 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 37 FKSNDTCLNNCEHSHYVF 90 FK + N C H HY F Sbjct: 43 FKPQNINANLCTHVHYAF 60 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 351 SS*IRLLDMECKLC 310 SS R+LD+ CK+C Sbjct: 28 SSSSRILDIPCKVC 41 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 351 SS*IRLLDMECKLC 310 SS R+LD+ CK+C Sbjct: 28 SSSSRILDIPCKVC 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,101 Number of Sequences: 336 Number of extensions: 3994 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -