BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B07 (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52950.1 68414.m05988 replication protein-related low similar... 28 7.5 >At1g52950.1 68414.m05988 replication protein-related low similarity to replication protein A1 GI:2258469 from (Oryza sativa) Length = 566 Score = 27.9 bits (59), Expect = 7.5 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +1 Query: 364 VRQTRMELNEDYTI--LKALYPGRNVKICC*YTHIKFDFNQTMITTLSANAHL*KAAATL 537 VR+ R + E TI LKA + VKI C I D++ + N + K+ TL Sbjct: 262 VREERSKQFERKTIAELKASFEVEKVKIICSILSIDLDYSWYYYAHIKCNKKVFKSKKTL 321 Query: 538 FQATNIAIIKVNAC 579 I + + C Sbjct: 322 SSGAKKIIYRCDKC 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,799,407 Number of Sequences: 28952 Number of extensions: 292820 Number of successful extensions: 563 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -