BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B06 (511 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 2.8 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 4.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 4.8 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 138 YQYVKKPKKI 167 YQ VKKPKKI Sbjct: 292 YQEVKKPKKI 301 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 4.8 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 38 LENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCK 151 L N + A + V + + NS+ W LG +CK Sbjct: 107 LVNLSVADLMVLLVCTPTVLVEVNSRPETWVLGREMCK 144 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 4.8 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 38 LENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCK 151 L N + A + V + + NS+ W LG +CK Sbjct: 107 LVNLSVADLMVLLVCTPTVLVEVNSRPETWVLGREMCK 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,650 Number of Sequences: 336 Number of extensions: 2157 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -