BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B06 (511 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0790 - 21214282-21214369,21214455-21214564,21215478-212155... 128 3e-30 08_01_0372 + 3286861-3286939,3287220-3287299,3289041-3289150,328... 128 3e-30 09_04_0106 - 14636773-14636863,14636948-14637057,14638107-146381... 126 8e-30 03_05_0642 - 26346260-26346367,26347902-26348162,26348542-263498... 29 2.9 01_05_0589 + 23459847-23460344,23460493-23461296 27 6.6 08_02_1022 + 23707993-23708528,23708620-23708706,23708807-237088... 27 8.8 02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 27 8.8 >08_02_0790 - 21214282-21214369,21214455-21214564,21215478-21215557, 21215659-21215737 Length = 118 Score = 128 bits (308), Expect = 3e-30 Identities = 64/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (1%) Frame = +3 Query: 45 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 224 MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 225 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 350 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104 >08_01_0372 + 3286861-3286939,3287220-3287299,3289041-3289150, 3289224-3289311 Length = 118 Score = 128 bits (308), Expect = 3e-30 Identities = 64/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (1%) Frame = +3 Query: 45 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 224 MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 225 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 350 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104 >09_04_0106 - 14636773-14636863,14636948-14637057,14638107-14638186, 14638302-14638380 Length = 119 Score = 126 bits (305), Expect = 8e-30 Identities = 63/104 (60%), Positives = 77/104 (74%), Gaps = 2/104 (1%) Frame = +3 Query: 45 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 224 MVQRLT+R+R SY TKSNQ R+V+TPGG+LVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 225 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 350 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVK 104 >03_05_0642 - 26346260-26346367,26347902-26348162,26348542-26349849, 26349960-26350178,26350241-26350300,26352159-26352215, 26352945-26353029,26353486-26353843,26353931-26355170 Length = 1231 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 78 SYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERS 233 S N NQ+R+V+ G + +KP+++ + KL+G RP R+ Sbjct: 1123 SNNQSQNQQRLVQVGGKQGAA--TQKPQRLSNARPAREKLKGDNAKRPGSRT 1172 >01_05_0589 + 23459847-23460344,23460493-23461296 Length = 433 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 238 RRERSAGLAGWIPRSLLLH*PHLGIFL 158 R +R + GW P+ L+L+ P +G+F+ Sbjct: 286 RGDRGRTIRGWAPQVLVLNHPAVGVFV 312 >08_02_1022 + 23707993-23708528,23708620-23708706,23708807-23708863, 23708955-23709261,23709545-23709631,23709720-23709767 Length = 373 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 233 GTFSRSSWLDTTEFALALTTPWDLLGLFYILINQAA 126 G + + SWL FA+ALT + L+ +LI Q A Sbjct: 22 GVYLQRSWLVLLMFAVALTPTYVLMEDLLLLIGQPA 57 >02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 Length = 489 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 241 QRRERSAGLAGWIPRSLLLH*PHLGIFL 158 + +ER LA W P+ L+L P +G+FL Sbjct: 354 ETKERGV-LASWCPQELVLSHPSVGLFL 380 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,318,964 Number of Sequences: 37544 Number of extensions: 240100 Number of successful extensions: 626 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -