BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B06 (511 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) 56 1e-08 SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) 30 0.96 SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) 29 2.9 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 29 2.9 SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 27 6.8 SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 27 9.0 >SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) Length = 58 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +3 Query: 216 RPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 347 RP + + +KTV R YGG C CVK+RI+RAFLIEEQKIV Sbjct: 2 RPMKLMHISKPQKTVSRAYGGSRCAACVKERIIRAFLIEEQKIV 45 >SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) Length = 299 Score = 30.3 bits (65), Expect = 0.96 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 62 IQATTVVQHKIKSKKNSKDTGWPLGLSV 145 I VQH K+KK + DT +P+G++V Sbjct: 45 ISGEYAVQHSCKNKKETIDTDYPIGMAV 72 >SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 69 RRLSYNTKSNQRRIVRTPGGRLVYQYVKKP 158 RR++ T SN R++RTP G+ ++ VK P Sbjct: 159 RRITKTTNSNSTRLIRTP-GQSIHIKVKAP 187 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +2 Query: 23 PAVKKLENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCKKAQEDPKVWSVQEQTPW 202 P VK+ ++AYI T+ + K+K+K T P V K A E+ K + +++ P+ Sbjct: 494 PVVKR---ASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPY 550 >SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 2 GRPMPXSPAVKKLENGAAAYIQATTVVQH-KIKSKKNSKD 118 GRP SP V +NG +Y A H ++KS + S D Sbjct: 457 GRPTQISPLVALKQNGLNSYCAADQGSAHTRVKSSRGSSD 496 >SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -3 Query: 305 LLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPW 168 L+D + + + + HCF+T+ T T ++ S T F L +PW Sbjct: 542 LIDELVKQSSCPSRAHCFITMTTTQTSTKISIAPTNTFFL---SPW 584 >SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 409 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +3 Query: 195 LRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKV 353 ++G++ R + S C R V +VY +C +C + V+ + E ++ KV Sbjct: 201 VKGVRDVRVNKVSERCLRGACVYKVYERCVCTRCTRGACVQG--LREVRVYKV 251 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 251 ENSETCLWWCPLP*MCQATHCQSLPH*RTKNCEGPQGTT 367 ++ + LW P+P Q + C+S P T E P TT Sbjct: 223 KHPDLMLWRKPVPKTDQQSECESSPGANTDRLESPARTT 261 >SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 150 LHTDKPSGHPVSLLFFFDLI 91 LHT +P+GHP ++ FD I Sbjct: 5 LHTTEPTGHPCHIVCCFDAI 24 >SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 293 MCQATHCQSLPH*RTKNCEGPQGTTGEH*VGKEGYKVNFR 412 +CQ HC LP R K+C+ P TG ++ Y+ R Sbjct: 115 VCQDDHCACLPCWRGKSCDQPD-LTGPPEFEQKEYEAEIR 153 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 314 DNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEF 192 DN LL + T +N FL + K G + L+ TEF Sbjct: 155 DNGLLFMETSAKTAMNVNDIFLAIGKKGKKKKGKTLNLTEF 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,013,625 Number of Sequences: 59808 Number of extensions: 274880 Number of successful extensions: 777 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -