BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B05 (493 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30550.1 68414.m03737 expressed protein similar to PIMT (GI:1... 28 3.9 At1g18960.1 68414.m02359 myb family transcription factor contain... 27 6.9 >At1g30550.1 68414.m03737 expressed protein similar to PIMT (GI:15127914) [Mus musculus]; similar to hypothetical protein GB:AAF19758 GI:6634778 from [Arabidopsis thaliana] Length = 391 Score = 27.9 bits (59), Expect = 3.9 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -1 Query: 184 ILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 59 I L +NN + G + N I F+ G+ + APS++G F +PP Sbjct: 82 IALAMNNAKVYGVA-NRIDFVTGDFMQLAPSLKGDVLFLSPP 122 >At1g18960.1 68414.m02359 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain; contains similarity to transcription factor GI:9759592 from [Arabidopsis thaliana] Length = 307 Score = 27.1 bits (57), Expect = 6.9 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -1 Query: 298 IPAKCSEKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGG 149 +P K E++ + L L E G H PFS +L E NI GG Sbjct: 89 LPGKTEEEVKMFWNTKLKKKLSEMG--IDHVTHRPFSHVLAEYGNINGGG 136 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,952,201 Number of Sequences: 28952 Number of extensions: 110906 Number of successful extensions: 209 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 209 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -