BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B02 (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13430.1 68418.m01546 ubiquinol-cytochrome C reductase iron-s... 141 3e-34 At5g13440.1 68418.m01547 ubiquinol-cytochrome C reductase iron-s... 141 5e-34 At5g62910.1 68418.m07894 expressed protein predicted proteins, A... 28 6.7 At5g54370.1 68418.m06770 late embryogenesis abundant protein-rel... 28 6.7 At3g48070.1 68416.m05241 expressed protein 28 6.7 At2g27660.1 68415.m03352 DC1 domain-containing protein contains ... 28 6.7 At4g03280.2 68417.m00448 cytochrome B6-F complex iron-sulfur sub... 27 8.9 At4g03280.1 68417.m00447 cytochrome B6-F complex iron-sulfur sub... 27 8.9 >At5g13430.1 68418.m01546 ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial, putative / Rieske iron-sulfur protein, putative similar to ubiquinol--cytochrome-c reductase from Solanum tuberosum [SP|P37841], Nicotiana tabacum [SP|P51132] [SP|P51133]; non-consensus AT acceptor splice site at exon 2 Length = 272 Score = 141 bits (342), Expect = 3e-34 Identities = 75/176 (42%), Positives = 100/176 (56%), Gaps = 3/176 (1%) Frame = +3 Query: 171 QGLKVKAGTRVPAQVRFAHTD---ISYPDFSAYRRKETQDPTSKANETIDERQSFTYLIX 341 QG ++ G+ VPA V T I Y D + + R DP+ +A F Y + Sbjct: 67 QGNEIGFGSEVPATVEAVKTPNSKIVYDDHN-HERYPPGDPSKRA---------FAYFVL 116 Query: 342 XXXXXXXXXXXXXXXTHFVSSMSAAADVLALAKIEIKLAEIPEGKSVTFKWRGKPLFIRH 521 + SMSA+ DVLALA +E+ L I G +VT KWRGKP+FIR Sbjct: 117 SGGRFVYASVLRLLVLKLIVSMSASKDVLALASLEVDLGSIEPGTTVTVKWRGKPVFIRR 176 Query: 522 RTADEISTEKAVPVDTLRDPQHDDQRTQNPKWLVVIGVCTHLGCVPVXNAGEFGGY 689 RT D+I +V V +LRDPQ D R +NP+WLVV+GVCTHLGC+P+ NAG++GG+ Sbjct: 177 RTEDDIKLANSVDVGSLRDPQEDSVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGW 232 >At5g13440.1 68418.m01547 ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial, putative / Rieske iron-sulfur protein, putative similar to ubiquinol--cytochrome-c reductase from Solanum tuberosum [SP|P37841], Nicotiana tabacum [SP|P51132] [SP|P51133] Length = 274 Score = 141 bits (341), Expect = 5e-34 Identities = 74/176 (42%), Positives = 100/176 (56%), Gaps = 3/176 (1%) Frame = +3 Query: 171 QGLKVKAGTRVPAQVRFAHTD---ISYPDFSAYRRKETQDPTSKANETIDERQSFTYLIX 341 QG ++ G+ VPA V T I Y D + + R DP+ +A F Y + Sbjct: 69 QGNEIGFGSEVPATVEAVKTPNSKIVYDDHN-HERYPPGDPSKRA---------FAYFVL 118 Query: 342 XXXXXXXXXXXXXXXTHFVSSMSAAADVLALAKIEIKLAEIPEGKSVTFKWRGKPLFIRH 521 + SMSA+ DVLALA +E+ L I G +VT KWRGKP+FIR Sbjct: 119 SGGRFVYASVLRLLVLKLIVSMSASKDVLALASLEVDLGSIEPGTTVTVKWRGKPVFIRR 178 Query: 522 RTADEISTEKAVPVDTLRDPQHDDQRTQNPKWLVVIGVCTHLGCVPVXNAGEFGGY 689 RT D+I +V V +LRDPQ D R +NP+WL+V+GVCTHLGC+P+ NAG++GG+ Sbjct: 179 RTEDDIKLANSVDVGSLRDPQEDSVRVKNPEWLIVVGVCTHLGCIPLPNAGDYGGW 234 >At5g62910.1 68418.m07894 expressed protein predicted proteins, Arabidopsis thaliana Length = 327 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 276 ESLCDGKPRNPGMKCQYERNVL 211 +++CDG R PG + YERN++ Sbjct: 281 KTICDGDGRCPGCRKPYERNMV 302 >At5g54370.1 68418.m06770 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein (GI:1350543)[Picea glauca] Length = 337 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 461 NSRRKVCHLQMERKTIVYPSQDSRRNLDREGCAC 562 NS+ KVC+ +R T + + N +R G AC Sbjct: 54 NSKNKVCYADCDRPTCKSQCRMRKPNCNRPGSAC 87 >At3g48070.1 68416.m05241 expressed protein Length = 319 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 276 ESLCDGKPRNPGMKCQYERNVL 211 +++CDG R PG + YERN + Sbjct: 273 KTICDGDGRCPGCRKPYERNTI 294 >At2g27660.1 68415.m03352 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 718 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 65 QPETSGGRTNTLRENGRPALA 127 QP T GGR R NGRP +A Sbjct: 639 QPRTMGGRPLQYRPNGRPNMA 659 >At4g03280.2 68417.m00448 cytochrome B6-F complex iron-sulfur subunit, chloroplast / Rieske iron-sulfur protein / plastoquinol-plastocyanin reductase (petC) identical to gi:9843639; identical to cDNA rieske iron-sulfur protein precursor (petC) GI:5725449 Length = 210 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = +3 Query: 603 QNPKWLVVIG---VCTHLGCVPVXNAGE 677 +N K L G VCTHLGCV N E Sbjct: 124 ENDKTLATYGINAVCTHLGCVVPWNKAE 151 >At4g03280.1 68417.m00447 cytochrome B6-F complex iron-sulfur subunit, chloroplast / Rieske iron-sulfur protein / plastoquinol-plastocyanin reductase (petC) identical to gi:9843639; identical to cDNA rieske iron-sulfur protein precursor (petC) GI:5725449 Length = 229 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = +3 Query: 603 QNPKWLVVIG---VCTHLGCVPVXNAGE 677 +N K L G VCTHLGCV N E Sbjct: 143 ENDKTLATYGINAVCTHLGCVVPWNKAE 170 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,385,893 Number of Sequences: 28952 Number of extensions: 317124 Number of successful extensions: 956 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -