BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A23 (574 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 27 0.57 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 1.7 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 1.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 2.3 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 23 5.3 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 5.3 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 7.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 9.3 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 9.3 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 26.6 bits (56), Expect = 0.57 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 16 LQLGFVIARSTLRTFKGTPIK*NIV*QNVSSTRP 117 L +GF + R T R P+K N N S+ RP Sbjct: 155 LTIGFAVYRVTERDLAQKPLKMNFFKYNASAARP 188 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 1.7 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 515 IIMLHINDLLFFGNSMGVDGLH--YTYQSESAEKQSQTIQYNVSRST 381 I +LH D + GN DGL Y S A+K QT+ N+ RST Sbjct: 117 IKLLH-PDAMTLGNHEFDDGLKGLRPYLSALAKKDIQTVATNLIRST 162 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 1.7 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 515 IIMLHINDLLFFGNSMGVDGLH--YTYQSESAEKQSQTIQYNVSRST 381 I +LH D + GN DGL Y S A+K QT+ N+ RST Sbjct: 117 IKLLH-PDAMTLGNHEFDDGLKGLRPYLSALAKKDIQTVATNLIRST 162 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 270 KRNLMPGTNTPYPPVPENIRRKQELFQRDNDLP 368 K L+ N P PPVPE + ++ N P Sbjct: 451 KSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTP 483 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 249 EACAAPGKRNLMPGTNTPYPPVPEN 323 E +A + N+ PGT P+ P N Sbjct: 73 ERFSAANRNNIQPGTYLPFGAGPRN 97 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 554 FISKCYHSKPSTNIIMLHINDLLFFGNSMGVDGLHYTY 441 +IS+C + TN+I +H L G DGL Y Sbjct: 899 YISRCTVCEAPTNVIAVHSQTLHIPECPNGWDGLWIGY 936 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 442 TNPRAQRSKVRRYSITSAGPPFRKTGKSLSLWK 344 T P+ RS S+ S PP + GK + W+ Sbjct: 133 TPPQDMRSMAGFRSLGSGAPPKAQGGKHVGNWE 165 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 92 YTIFYFIGVPLNVRKVDRAITKPSCRSS 9 + I F + +++R DRA TKP ++S Sbjct: 281 FIIMAFCYICVSIRLNDRARTKPGSKTS 308 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 548 SKCYHSKPSTNIIMLHINDLLFFGNSMGVDGL 453 S+ YH +P T++ + I D + + G+DG+ Sbjct: 425 SEPYHIRPVTDLELERIADDMCSRKAPGLDGI 456 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,309 Number of Sequences: 2352 Number of extensions: 13086 Number of successful extensions: 29 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -