BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A22 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.23 DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 pr... 26 0.40 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 26 0.40 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 26 0.40 AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-ri... 26 0.40 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 26 0.40 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 26 0.40 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 26 0.40 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 25 0.53 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.9 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 22 6.5 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 26.6 bits (56), Expect = 0.23 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 33 NIERSNYNQFTEFTSYQNRVYRALYYEL 116 N +NYN + + + N Y+ LYY + Sbjct: 328 NNYNNNYNNYNNYNNNYNNNYKKLYYNI 355 >DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 precursor protein. Length = 223 Score = 25.8 bits (54), Expect = 0.40 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 462 EYKRNIAKVAALSS-EKDVILARLDDLPSWVFFPDVERAEWLNRILLQVWPN-VNSYAKT 635 E ++N+ V L S E+D ++A D PS F E + W LL+ PN ++ + +T Sbjct: 30 EERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLR--PNFLDGWYQT 87 Query: 636 L 638 L Sbjct: 88 L 88 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-rich protein precursor protein. Length = 223 Score = 25.8 bits (54), Expect = 0.40 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 462 EYKRNIAKVAALSS-EKDVILARLDDLPSWVFFPDVERAEWLNRILLQVWPN-VNSYAKT 635 E ++N+ V L S E+D ++A D PS F E + W LL+ PN ++ + +T Sbjct: 30 EERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLR--PNFLDGWYQT 87 Query: 636 L 638 L Sbjct: 88 L 88 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 25.8 bits (54), Expect = 0.40 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 462 EYKRNIAKVAALSS-EKDVILARLDDLPSWVFFPDVERAEWLNRILLQVWPN-VNSYAKT 635 E ++N+ V L S E+D ++A D PS F E + W LL+ PN ++ + +T Sbjct: 30 EERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLR--PNFLDGWYQT 87 Query: 636 L 638 L Sbjct: 88 L 88 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 346 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.8 bits (54), Expect = 0.40 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 346 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.4 bits (53), Expect = 0.53 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 18 VLTYQNIERSNYNQFTEFTSYQNRVYRALYYEL 116 +++ N +NYN + +Y Y LYY + Sbjct: 81 IISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 33 NIERSNYNQFTEFTSYQNRVYRALYY 110 N + SNYN + +Y N Y+ L Y Sbjct: 88 NYKYSNYNNYNN-NNYNNNNYKKLQY 112 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 33 NIERSNYNQFTEFTSYQNRVYRALYY 110 N + SNYN + +Y N Y+ L Y Sbjct: 88 NYKYSNYNNYNN-NNYNNNNYKKLQY 112 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 33 NIERSNYNQFTEFTSYQNRVYRALYY 110 N + SNYN + +Y N Y+ L Y Sbjct: 88 NYKYSNYNNYNN-NNYNNNNYKKLQY 112 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 33 NIERSNYNQFTEFTSYQNRVYRALYY 110 N + SNYN + +Y N Y+ L Y Sbjct: 88 NYKYSNYNNYNN-NNYNNNNYKKLQY 112 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 27 YQNIERSNYNQFTEFTSYQNRV 92 Y N +NYN + + Y+N + Sbjct: 330 YNNYNNNNYNNYNKKLYYKNYI 351 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 201 FNHENTCNAAVV*CSMASDNNM 266 F +EN N + CS SD N+ Sbjct: 91 FLNENEINQLITECSAISDTNV 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,032 Number of Sequences: 438 Number of extensions: 4389 Number of successful extensions: 27 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -