BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A16 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22707| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) 29 3.9 SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) 28 5.2 SB_17774| Best HMM Match : F5_F8_type_C (HMM E-Value=0.066) 28 5.2 SB_40389| Best HMM Match : DUF590 (HMM E-Value=0) 27 9.1 SB_32514| Best HMM Match : VWA (HMM E-Value=0.32) 27 9.1 >SB_22707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 58.8 bits (136), Expect = 3e-09 Identities = 45/138 (32%), Positives = 63/138 (45%), Gaps = 10/138 (7%) Frame = +2 Query: 224 INLLGRVIHVSDVKIKVSMPCKLLGNVMACHISESYNKLLEAYVEDKTEK-----VRELS 388 + LLG V V + ++ +S+P L G V HI + KL+ A + TE+ + L Sbjct: 1 MKLLGAVKEVGEFELIISLPNGLSGFV---HILDINEKLMSALAKSSTEERIEDSIPSLG 57 Query: 389 QMFKPGQYIAVSVVELAPGN-----TMLTTMPQHVNSGKRHTDIXKGAIFQAXVSSXEXH 553 +F + V EL L+ P+ VN+G T I G + VSS E H Sbjct: 58 DLFTVNSLVVCVVKELLGSKHGHRKVKLSLRPEDVNAGV--TTIVPGFVLPGCVSSVEDH 115 Query: 554 GYVMDLGIPNTTAFLPXK 607 GYV+ GIP T FL K Sbjct: 116 GYVLSFGIPGKTGFLSKK 133 >SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) Length = 581 Score = 28.7 bits (61), Expect = 3.9 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 6/98 (6%) Frame = +2 Query: 140 SDEAQDYLKTHKLNNNLIFLSSKSLRPGINLLGRVIHVSD-VKIKVSMPCKLLGNVMACH 316 S+ + Y+ HK+NN+L + + I+ + D +I +P KL G + A H Sbjct: 389 SNSIKQYMNNHKVNNDL----QERVISWIDYMWHKKRSLDHERILEKLPEKLRGQI-AVH 443 Query: 317 ISESYNKLLEAYVEDKTEKVREL-----SQMFKPGQYI 415 + + + + + + + +RE+ SQ+F PG YI Sbjct: 444 VYLAVLRQVPVFADCEPGLLREIVVKLRSQVFSPGDYI 481 >SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) Length = 555 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 490 FPTVYVLRHSRQHGVA 443 FPTVY LRH R +G++ Sbjct: 458 FPTVYTLRHGRDNGLS 473 >SB_17774| Best HMM Match : F5_F8_type_C (HMM E-Value=0.066) Length = 220 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 490 FPTVYVLRHSRQHGVA 443 FPTVY LRH R +G++ Sbjct: 123 FPTVYTLRHGRDNGLS 138 >SB_40389| Best HMM Match : DUF590 (HMM E-Value=0) Length = 320 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -1 Query: 475 VLRHSRQHGVARCQFHYTHSYVLTRFEHL*QFTNFFSLIFNISF 344 +L H H R Q Y + L F + QFTNF+S IF I+F Sbjct: 57 LLNHWEMH---RTQTEYEDNLTLKVF--IFQFTNFYSSIFYIAF 95 >SB_32514| Best HMM Match : VWA (HMM E-Value=0.32) Length = 136 Score = 27.5 bits (58), Expect = 9.1 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 7/116 (6%) Frame = +2 Query: 161 LKTHKLNNNLIFLSSKSLRPGINLLGRVIHVSDVKIKVSMPCKLLGNVMACHI------S 322 L+T N+N + ++ P I IH VSM +L+G MAC + Sbjct: 9 LQTFTGNSNRNSVVRNAVSPAIEARFVRIHPKSWHNHVSMRVELIGCFMACKVDVGILMD 68 Query: 323 ESYNKLLEAYVEDKTEKVRELSQMFK-PGQYIAVSVVELAPGNTMLTTMPQHVNSG 487 ES + + + ++K E V++L + F+ GQY V+ + + + H + G Sbjct: 69 ESGSVKQDDFTKEK-EFVKDLVRHFQIGGQYAQFGVISFSTHAHLDIALNSHSSVG 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,024,931 Number of Sequences: 59808 Number of extensions: 342304 Number of successful extensions: 741 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -