BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A04 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 23 2.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 3.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 3.8 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 314 DMYKGVYNGSRKHEPDLDV 370 ++YK ++NG RK+ D+ Sbjct: 209 ELYKEIFNGKRKNPNGCDI 227 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = -2 Query: 438 LSSRLPPVTMILLMPLVQALSSTTSKSGSCFLDPLYTPLYISSVRLAP 295 LSS P M+L P S + S + L TP V+L P Sbjct: 690 LSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPP 737 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = -2 Query: 438 LSSRLPPVTMILLMPLVQALSSTTSKSGSCFLDPLYTPLYISSVRLAP 295 LSS P M+L P S + S + L TP V+L P Sbjct: 582 LSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPP 629 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,484 Number of Sequences: 336 Number of extensions: 2780 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -