BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A04 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 23 6.3 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 23 6.3 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 23 6.3 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 419 GGSLEDSKKAIELSRTDSKLFTTVGCHPTRCSEF 520 G ++ A++ T L TVG HPT EF Sbjct: 476 GEVIQGFAAALKCGLTMQVLRNTVGIHPTVAEEF 509 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 419 GGSLEDSKKAIELSRTDSKLFTTVGCHPTRCSEF 520 G ++ A++ T L TVG HPT EF Sbjct: 452 GEVIQGFAAALKCGLTMQVLRNTVGIHPTVAEEF 485 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 419 GGSLEDSKKAIELSRTDSKLFTTVGCHPTRCSEF 520 G ++ A++ T L TVG HPT EF Sbjct: 449 GEVIQGFAAALKCGLTMQVLRNTVGIHPTVAEEF 482 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,684 Number of Sequences: 2352 Number of extensions: 11102 Number of successful extensions: 111 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -