BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_A03 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) 27 6.5 SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_15612| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) 27 6.5 SB_45326| Best HMM Match : Ank (HMM E-Value=5.2) 27 8.6 SB_21950| Best HMM Match : PTN_MK_N (HMM E-Value=4.8) 27 8.6 SB_19719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_10821| Best HMM Match : TFIIB (HMM E-Value=0.35) 27 8.6 SB_8542| Best HMM Match : PT (HMM E-Value=4) 27 8.6 SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) 27 8.6 >SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 28.3 bits (60), Expect = 2.8 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = +2 Query: 215 NPDVSWNKKTNPEPWEAYRNKQYKFYSPIRDYSKEESPAPKY*TVFLILISCITRILXV 391 N + + N+K +P W +Y R + SP+P Y T+ + + IT I + Sbjct: 81 NDEPNNNEKLDPTFWVSYTPTPLSHRYHHRHHHTSPSPSPPYITITITITITITTITTI 139 >SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) Length = 1774 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 237 RRPTLNHGRLTGTSSTSSILPSETT 311 +RP L T T STSS +PSE T Sbjct: 830 QRPRLGISPTTKTCSTSSFIPSEVT 854 >SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 271 PVSLPWFRVGLLVPRYIRITXSQTQSIEHSSTTSYPHTYI 152 PV+L WFRV L+ ++ QT+S + TY+ Sbjct: 286 PVNL-WFRVELIAIEFLATDFEQTRSATDDAALESKQTYV 324 >SB_15612| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) Length = 343 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/46 (32%), Positives = 30/46 (65%) Frame = +3 Query: 195 LCVWLCVILMYLGTRRPTLNHGRLTGTSSTSSILPSETTLRRNLLP 332 +CV+ V +Y+G RPTL +L ++++ +LP+ L+++L+P Sbjct: 253 VCVFSNVGGVYMGQHRPTLLE-QLVDSTTSQKMLPN-IVLQQHLIP 296 >SB_45326| Best HMM Match : Ank (HMM E-Value=5.2) Length = 309 Score = 26.6 bits (56), Expect = 8.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 121 FEEA*GFDPSVCMCGDRMWWSCV 189 +E GFD +V +C +WW + Sbjct: 237 WERESGFDKTVALCRGGLWWDAI 259 >SB_21950| Best HMM Match : PTN_MK_N (HMM E-Value=4.8) Length = 406 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 334 GGRRFLLRVVSDGRIELVLLVPVSLPWFRVGLLVP-RYIRITXSQTQSIE 188 G RR+ RV L L P++LP+ R L P R + + + QS E Sbjct: 93 GPRRYATRVQKHDYARLTLKNPIALPFMRRHQLTPQRIMGVVETVVQSNE 142 >SB_19719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 26.6 bits (56), Expect = 8.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 206 AXRNPDVSWNKKTNPEPWEAYRNKQYKFYSPIRDYSKEESP 328 A R+PDVS + + P + RN+Q IR++ + P Sbjct: 40 AHRHPDVSTGRNSPSYPHWSSRNRQMARSMVIREFMTDNGP 80 >SB_10821| Best HMM Match : TFIIB (HMM E-Value=0.35) Length = 473 Score = 26.6 bits (56), Expect = 8.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 121 FEEA*GFDPSVCMCGDRMWWSCV 189 +E GFD +V +C +WW + Sbjct: 421 WERESGFDKTVALCRGGLWWDAI 443 >SB_8542| Best HMM Match : PT (HMM E-Value=4) Length = 650 Score = 26.6 bits (56), Expect = 8.6 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +2 Query: 215 NPDVSWNKKTNPEPW-EAYRNKQYKFY---SPIRDYSKEESPAPKY 340 NP + NP+PW N Q K+Y +P Y +P PKY Sbjct: 170 NPQPKYYPSGNPQPWYYPSGNPQPKYYPSGNPQSRYYPCGNPQPKY 215 >SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1528 Score = 26.6 bits (56), Expect = 8.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 240 FLFQDTSGLRXARRRV*NTAPPHPIPTHT 154 ++ D S L+ A NT PPHP P HT Sbjct: 988 YIVTDVS-LQSAMSERTNTYPPHPPPIHT 1015 >SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) Length = 892 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 203 DAEYRTQLHHILSPHIHTEGSKPYASSN 120 D+ Q HI +PH +EGS Y+S++ Sbjct: 734 DSRVAAQAIHINAPHTCSEGSSSYSSAS 761 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,729,219 Number of Sequences: 59808 Number of extensions: 253258 Number of successful extensions: 595 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -