BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0959 (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 3.3 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 3.3 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 7.6 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/30 (30%), Positives = 21/30 (70%) Frame = +3 Query: 510 KMTTAXXKRDENLKKMIQRLREHEEQVRKV 599 +MT +R +++KK+ Q L +E+Q++++ Sbjct: 741 EMTRKLHQRQQHMKKLQQELLTNEQQLQQL 770 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 3.3 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = -3 Query: 334 YSSARCGC---GTPPRSWPS 284 YSS++CGC P WPS Sbjct: 338 YSSSQCGCPDIPPAPNMWPS 357 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 7.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 156 TPTGSASITSYARPPFDISWQRISVDLVSTSMAST 52 TP S+ +ARP +++ +S+ +T +A T Sbjct: 650 TPNSVGSLQEFARPYRNMATTPVSIRFTNTVIART 684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,190 Number of Sequences: 2352 Number of extensions: 5694 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -