BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0958 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 99 1e-21 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 99 1e-21 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 99 1e-21 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 42 5e-04 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 41 6e-04 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 40 0.001 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 37 0.010 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 36 0.030 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 34 0.070 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 33 0.12 At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta... 33 0.16 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 33 0.16 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 32 0.28 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 32 0.28 At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ... 32 0.37 At5g64630.3 68418.m08123 transducin family protein / WD-40 repea... 31 0.49 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 31 0.49 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 31 0.49 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 31 0.49 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 31 0.49 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 31 0.49 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 31 0.65 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 0.65 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 31 0.86 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 31 0.86 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 31 0.86 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 31 0.86 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 31 0.86 At1g04510.1 68414.m00442 transducin family protein / WD-40 repea... 30 1.5 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 29 2.0 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 29 2.0 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 29 2.0 At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ... 29 2.6 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 29 2.6 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 29 2.6 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 29 2.6 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 29 2.6 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 29 2.6 At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 ... 29 3.5 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 28 4.6 At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protei... 28 4.6 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 28 6.1 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 28 6.1 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 27 8.0 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 27 8.0 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 27 8.0 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 27 8.0 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 27 8.0 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 99 bits (238), Expect = 1e-21 Identities = 45/86 (52%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Frame = +3 Query: 255 IAFSPNNNXVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQ 431 +A PNN VHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 25 VALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL 84 Query: 432 GDDGKWATTLVLLRINRAATCVKWSP 509 + +W TLV+LR+NRAA CV+WSP Sbjct: 85 -EGAEWVPTLVILRLNRAALCVQWSP 109 Score = 71.3 bits (167), Expect = 5e-13 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 512 ENKFAVGSGARLISICYFEKENNWWVSKHIKKPIRSTVTSIDW 640 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K S+VTS+ W Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAW 153 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +3 Query: 291 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 Y++E N W H+ V + W PN + T S D V++ Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFS 173 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 99 bits (238), Expect = 1e-21 Identities = 45/86 (52%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Frame = +3 Query: 255 IAFSPNNNXVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQ 431 +A PNN VHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 25 VALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL 84 Query: 432 GDDGKWATTLVLLRINRAATCVKWSP 509 + +W TLV+LR+NRAA CV+WSP Sbjct: 85 -EGAEWVPTLVILRLNRAALCVQWSP 109 Score = 71.3 bits (167), Expect = 5e-13 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 512 ENKFAVGSGARLISICYFEKENNWWVSKHIKKPIRSTVTSIDW 640 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K S+VTS+ W Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAW 153 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +3 Query: 291 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT---QGDDGKWA 452 Y++E N W H+ V + W PN + T S D V++ +G D K+A Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKGVDTKYA 184 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 99 bits (238), Expect = 1e-21 Identities = 45/86 (52%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Frame = +3 Query: 255 IAFSPNNNXVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQ 431 +A PNN VHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ Sbjct: 25 VALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL 84 Query: 432 GDDGKWATTLVLLRINRAATCVKWSP 509 + +W TLV+LR+NRAA CV+WSP Sbjct: 85 -EGAEWVPTLVILRLNRAALCVQWSP 109 Score = 71.3 bits (167), Expect = 5e-13 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 512 ENKFAVGSGARLISICYFEKENNWWVSKHIKKPIRSTVTSIDW 640 ENKFAVGSGA+ + ICY+E+ENNWWVSK I+K S+VTS+ W Sbjct: 111 ENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAW 153 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +3 Query: 291 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 Y++E N W H+ V + W PN + T S D V++ Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFS 173 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/81 (23%), Positives = 39/81 (48%) Frame = +3 Query: 288 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 467 I+K G++++ + L H+ V + W + + + TCS D++ ++W + ++ VL Sbjct: 100 IWKNYGSEFECISTLEGHENEVKSVSWNASGSCLATCSRDKSVWIWEVLEGNEYDCAAVL 159 Query: 468 LRINRAATCVKWSPWRTSLLS 530 + V+W P L S Sbjct: 160 TGHTQDVKMVQWHPTMDVLFS 180 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +3 Query: 300 EGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYV-WTQGDDGKWATTLVLLRI 476 EGN++ L H V + W P + + +CS D V W++ DDG++ L Sbjct: 149 EGNEYDCAAVLTGHTQDVKMVQWHPTMDVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGES 208 Query: 477 NRAATCVKWS 506 N + WS Sbjct: 209 NNGHSSTVWS 218 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 41.1 bits (92), Expect = 6e-04 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +3 Query: 297 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTCSV-DRNAYVWTQGDDGKWATTLV 464 KEGN W Q + +H + V I WAP+ + + C D N V++ DG W TT + Sbjct: 86 KEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKI 145 Query: 465 LLRINRAATCVKWSP 509 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 297 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 467 KEG W+ T L + V + W+ N + + N VW + DG+W V+ Sbjct: 245 KEGEQWEGTV-LKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVV 300 Score = 31.5 bits (68), Expect = 0.49 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +3 Query: 273 NNXVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 434 ++ V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIG 244 Query: 435 DDGKWATTLVLLRINRAATCVKWS 506 +G+ VL V WS Sbjct: 245 KEGEQWEGTVLKDFKTPVWRVSWS 268 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/67 (23%), Positives = 27/67 (40%), Gaps = 2/67 (2%) Frame = +3 Query: 330 LVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 503 L H V + WA P ++ +CS D +W +G+ +W V + + W Sbjct: 52 LTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAW 111 Query: 504 SPWRTSL 524 +P L Sbjct: 112 APHELGL 118 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +3 Query: 297 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTC-SVDRNAYVWTQGDDGKWATTLV 464 KEGN W Q + +H V I WAP+ + + C S D N V+T DG W T+ + Sbjct: 86 KEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSLACGSSDGNISVFTARADGGWDTSRI 145 Query: 465 LLRINRAATCVKWSP 509 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 33.1 bits (72), Expect = 0.16 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +3 Query: 273 NNXVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 434 +N V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVIIWTVG 244 Query: 435 DDGKWATTLVLLRINRAATCVKWS 506 +G+ VL V WS Sbjct: 245 KEGEQWEGKVLKDFMTPVWRVSWS 268 Score = 32.3 bits (70), Expect = 0.28 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +3 Query: 315 KQTNNLVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAA 488 +Q L H V + WA P I+ +CS D +W +G+ +W V + Sbjct: 47 QQLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSV 106 Query: 489 TCVKWSP 509 + W+P Sbjct: 107 NSIAWAP 113 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 297 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKW 449 KEG W + L + V + W+ N + + N VW + DG+W Sbjct: 245 KEGEQW-EGKVLKDFMTPVWRVSWSLTGNLLAVSDGNNNVTVWKEAVDGEW 294 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 37.1 bits (82), Expect = 0.010 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG 443 H + + W+P++ R++T S D++A VW +DG Sbjct: 95 HKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDG 129 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 273 NNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 N ++ +E K NN++ H R+ + W+PN + T S+D V+ Sbjct: 377 NREAVVWDRETKQVK-LNNMLFHTARINSLAWSPNNKMVATGSIDTCVIVY 426 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 35.5 bits (78), Expect = 0.030 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 342 DLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 DL+V +DW P NRIV+ S D VW Sbjct: 3 DLQVYSLDWTPERNRIVSASQDGRLIVW 30 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 34.3 bits (75), Expect = 0.070 Identities = 18/83 (21%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = +3 Query: 288 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW--TQGDDGKWATTL 461 +++ D + + L H+ V + W + + + TC D++ ++W +D ++ T Sbjct: 74 VWENFATDSESVSVLRGHESEVKSVSWNASGSLLATCGRDKSVWIWEIQPEEDDEFDTIA 133 Query: 462 VLLRINRAATCVKWSPWRTSLLS 530 VL + V W P L S Sbjct: 134 VLTGHSEDVKMVLWHPTMDVLFS 156 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 288 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW-TQGDDGKWATTLV 464 I +E +++ L H V + W P + + +CS D +W ++ +DG + Sbjct: 121 IQPEEDDEFDTIAVLTGHSEDVKMVLWHPTMDVLFSCSYDNTIKIWCSEDEDGDYNCVQT 180 Query: 465 LLRINRAATCVKWS 506 L +N + WS Sbjct: 181 LSELNNGHSSTVWS 194 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 315 KQTNNLVEHDLRVMGIDWAPNTNRIV-TCSVDRNAYVWTQ 431 ++ L H RV + W P + ++ +CS D+ +W Q Sbjct: 11 EEVQKLEGHTDRVWNVAWNPAADGVIASCSADKTVRIWEQ 50 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 33.5 bits (73), Expect = 0.12 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 467 H + + W+P+ +++T S D++A +W D+G + L Sbjct: 231 HKGSIYAVSWSPDGKQVLTVSADKSAKIWDISDNGSGSLNTTL 273 >At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 347 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 H +V +DW P NRIV+ S D VW Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVW 92 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 H +V +DW P NRIV+ S D VW Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVW 92 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 32.3 bits (70), Expect = 0.28 Identities = 20/67 (29%), Positives = 28/67 (41%) Frame = +3 Query: 330 LVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSP 509 LV H V + ++ + + T S D A +W DD K L + V WSP Sbjct: 220 LVAHKNEVWFVQFSNSGKYLATASSDCTAIIWKVLDDNKVELKHTLESHQNPVSFVSWSP 279 Query: 510 WRTSLLS 530 T LL+ Sbjct: 280 DDTKLLT 286 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 32.3 bits (70), Expect = 0.28 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +3 Query: 309 DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 +WK L H V+ ++W+P+ + + + S+D ++W Sbjct: 107 NWKAVMTLRGHTADVVDLNWSPDDSMLASGSLDNTVHIW 145 Score = 28.3 bits (60), Expect = 4.6 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +3 Query: 273 NNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGD----- 437 +N VHI+ T L H V G+ W P + I + S D+ +W D Sbjct: 139 DNTVHIWNMRTG--MCTTVLRGHLSLVKGVTWDPIGSFIASQSDDKTVIIWRTSDWGMAH 196 Query: 438 --DGKWATTL 461 DG WA +L Sbjct: 197 RTDGHWAKSL 206 >At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Fzr1 (GI:6463679){Homo sapiens} Length = 481 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +3 Query: 324 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 503 + LV H V G+ W+ + + + D VW ++ L L A + W Sbjct: 292 SKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVW---NNHSQQPILKLTEHTAAVKAITW 348 Query: 504 SPWRTSLLS 530 SP ++SLL+ Sbjct: 349 SPHQSSLLA 357 >At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 428 Score = 31.5 bits (68), Expect = 0.49 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 288 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 ++ E N WK +L H V+ + W+P+ +++ SVD + +W Sbjct: 34 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW 80 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 31.5 bits (68), Expect = 0.49 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 288 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 ++ E N WK +L H V+ + W+P+ +++ SVD + +W Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW 139 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 31.5 bits (68), Expect = 0.49 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 288 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 ++ E N WK +L H V+ + W+P+ +++ SVD + +W Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW 139 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 509 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 265 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 324 Query: 510 WRTSLLS 530 ++ +LL+ Sbjct: 325 FQANLLA 331 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 509 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 255 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 314 Query: 510 WRTSLLS 530 ++ +LL+ Sbjct: 315 FQANLLA 321 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWS 506 H + W P ++ T S D+ +W+ +D + LVL + T V W+ Sbjct: 695 HKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLPPFGSSVTAVAWT 750 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 31.1 bits (67), Expect = 0.65 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +3 Query: 339 HDLRVMGIDWAPNTNRIV-TCSVDRNAYVWTQGD---DGKWATTLVLLRINRAATCVKWS 506 HD + +DW P+ N ++ T S D V+ + + +G + A CV+WS Sbjct: 325 HDADLHCVDWNPHDNNLILTGSADNTVRVFDRRNLTSNGVGSPVYKFEGHRAAVLCVQWS 384 Query: 507 PWRTSLLSGQELD 545 P ++S+ D Sbjct: 385 PDKSSVFGSSAED 397 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 303 GNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT-QGDD 440 G D+ +L H+ +V +D +++ I T S DR +WT G+D Sbjct: 495 GRDFSLVKSLAGHESKVASLDITADSSCIATVSHDRTIKLWTSSGND 541 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 249 KSIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 K +A + ++ V I+ E + T EH + + + PN+ ++ T S D+ +W Sbjct: 521 KLLASAGHDKKVFIWNMETLQVESTPE--EHAHIITDVRFRPNSTQLATSSFDKTIKIWD 578 Query: 429 QGDDGKWATTL 461 D G + T+ Sbjct: 579 ASDPGYFLRTI 589 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 249 KSIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 K +A + ++ V I+ E + T EH + + + PN+ ++ T S D+ +W Sbjct: 523 KLLASAGHDKKVFIWNMETLQVESTPE--EHAHIITDVRFRPNSTQLATSSFDKTIKIWD 580 Query: 429 QGDDGKWATTL 461 D G + T+ Sbjct: 581 ASDPGYFLRTI 591 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 249 KSIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 K +A + ++ V I+ E + T EH + + + PN+ ++ T S D+ +W Sbjct: 523 KLLASAGHDKKVFIWNMETLQVESTPE--EHAHIITDVRFRPNSTQLATSSFDKTIKIWD 580 Query: 429 QGDDGKWATTL 461 D G + T+ Sbjct: 581 ASDPGYFLRTI 591 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 249 KSIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 K +A + ++ V I+ E + T EH + + + PN+ ++ T S D+ +W Sbjct: 523 KLLASAGHDKKVFIWNMETLQVESTPE--EHAHIITDVRFRPNSTQLATSSFDKTIKIWD 580 Query: 429 QGDDGKWATTL 461 D G + T+ Sbjct: 581 ASDPGYFLRTI 591 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +3 Query: 249 KSIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 428 K +A + ++ V I+ E + T EH + + + PN+ ++ T S D+ +W Sbjct: 523 KLLASAGHDKKVFIWNMETLQVESTPE--EHAHIITDVRFRPNSTQLATSSFDKTIKIWD 580 Query: 429 QGDDGKWATTL 461 D G + T+ Sbjct: 581 ASDPGYFLRTI 591 >At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 523 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 324 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWAT 455 + L H +V I + +T+ ++T S D+ +W +DG + + Sbjct: 258 STLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIWGCSEDGNYTS 301 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/87 (21%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +3 Query: 252 SIAFSPNNNXVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQ 431 +++F+ ++ IY + + + H V + W P + + +CS D A +W Sbjct: 418 NVSFATSSTDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIW-- 475 Query: 432 GDDGKWATTLVLLRIN-RAATCVKWSP 509 + K +T + LR + + ++WSP Sbjct: 476 --NIKQSTFVHDLREHTKEIYTIRWSP 500 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +3 Query: 324 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWA 452 + L H +V + + +++ ++T S D+ +W DG +A Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYA 300 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +3 Query: 324 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWA 452 + L H +V + + +++ ++T S D+ +W DG +A Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYA 300 >At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 29.1 bits (62), Expect = 2.6 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 7/82 (8%) Frame = +3 Query: 306 NDWKQTNNLVE----HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLR 473 ND + +++VE H V G+ W+ + N+ + D ++W + T L R Sbjct: 236 NDVRIRSSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTRQWLHR 295 Query: 474 INRAATCVK---WSPWRTSLLS 530 V+ W P++ SLL+ Sbjct: 296 FEEHTAAVRALAWCPFQASLLA 317 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = +3 Query: 315 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 494 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 495 VKWSP 509 V+++P Sbjct: 402 VQFNP 406 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = +3 Query: 315 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 494 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 495 VKWSP 509 V+++P Sbjct: 402 VQFNP 406 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +3 Query: 318 QTNNLVE-HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 494 QT ++E H V + ++ N + + S D+ A +W DG + L+ ++ Sbjct: 265 QTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIA 324 Query: 495 VKWSP 509 + WSP Sbjct: 325 ILWSP 329 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 315 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG 443 K L EH + I ++P+ R+ T S D+ VW + G Sbjct: 684 KPKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRVWDADNKG 726 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 288 IYKKEGN--DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 +Y+K+G+ + + L H V + ++PN+ +I+T S D + VW Sbjct: 269 VYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVW 316 >At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 WD repeats (PF00400); similar to Fzr1 (GI:6463679) {Homo sapiens}; similar to WD repeat protein Srw1 -Schizosaccharomyces pombe,PID:d1023012 Length = 475 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 3/72 (4%) Frame = +3 Query: 324 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK- 500 + L H + G+ W+ + + + D +VW Q +T +LR A VK Sbjct: 286 SKLKGHKSEICGLKWSSDNRELASGGNDNKLFVWNQ------HSTQPVLRFCEHAAAVKA 339 Query: 501 --WSPWRTSLLS 530 WSP LL+ Sbjct: 340 IAWSPHHFGLLA 351 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 360 IDWAPNTNRIVTCSVDRNAYVW 425 +DW PN N I T S D+ +W Sbjct: 505 VDWHPNCNYIATGSSDKTVRLW 526 >At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protein-related contains Pfam profile PF00026: Eukaryotic aspartyl protease;b similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 449 Score = 28.3 bits (60), Expect = 4.6 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = -3 Query: 518 CSPWRPFHASRCSVDTQKN-KSSCPFPIISLSPDVSITVNRTRNNTVGVGSPINPHHSKV 342 CSP+ P H S +DT + SS + LS S+ + + +V V S H Sbjct: 48 CSPFAPTHVSASVIDTVLHMASSDSHRLTYLS---SLVAGKPKPTSVPVASGNQLHIGNY 104 Query: 341 VFHKVVCLLPVISFLFVYVNXIIVW*ECN 255 V + P + F+ + + VW C+ Sbjct: 105 VVRAKLGTPPQLMFMVLDTSNDAVWLPCS 133 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Frame = +3 Query: 333 VEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---W 503 V H V G+ W+ + ++ + D ++W + T L R V+ W Sbjct: 233 VGHTEEVCGLKWSESGKKLASGGNDNVVHIWDRSLASSNPTRQWLHRFEEHTAAVRALAW 292 Query: 504 SPWRTSLLS 530 P++ SLL+ Sbjct: 293 CPFQASLLA 301 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 4/73 (5%) Frame = +3 Query: 339 HDLRVMGIDWAPNT-NRIVTCSVDRNAYVWTQGD---DGKWATTLVLLRINRAATCVKWS 506 HD + +DW P+ N I+T S D ++ + +G + A CV+WS Sbjct: 336 HDADLHCVDWNPHDDNLILTGSADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLCVQWS 395 Query: 507 PWRTSLLSGQELD 545 P ++S+ D Sbjct: 396 PDKSSVFGSSAED 408 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 339 HDLRVMGIDWAPN-TNRIVTCSVDRNAYVW 425 HD V +DW+P+ ++ T S D +W Sbjct: 380 HDFEVTAVDWSPSEIGKVATASDDFTVRLW 409 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 327 NLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 425 +L H L VM ID + + IVT S D+N +W Sbjct: 577 SLYGHKLPVMCIDISSDGELIVTGSQDKNLKIW 609 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 306 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 434 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 306 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 434 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 306 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 434 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,188,950 Number of Sequences: 28952 Number of extensions: 299731 Number of successful extensions: 897 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -