BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0952 (644 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identi... 32 0.28 At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identi... 31 0.87 At3g03910.1 68416.m00405 glutamate dehydrogenase, putative simil... 29 2.0 >At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identical to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 32.3 bits (70), Expect = 0.28 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 268 RQMLAMGFTNEGGWLVELLEKKDGNIAAVLDLLTPVNPK 384 ++ + GF N G W +L+ +K G I AV D+ + K Sbjct: 207 QRFVIQGFGNVGSWAAKLISEKGGKIVAVSDITGAIKNK 245 >At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identical to glutamate dehydrogenase 2 (GDH 2) [Arabidopsis thaliana] SWISS-PROT:Q38946 Length = 411 Score = 30.7 bits (66), Expect = 0.87 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +1 Query: 247 ATYDEALRQM--LAMGFTNEGGWLVELLEKKDGNIAAVLDLLTPV-NPK 384 A Y ++++ + + GF N G W +L+ +K G + AV D+ + NP+ Sbjct: 198 AEYGKSIQGLTFVIQGFGNVGTWAAKLIHEKGGKVVAVSDITGAIRNPE 246 >At3g03910.1 68416.m00405 glutamate dehydrogenase, putative similar to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 286 GFTNEGGWLVELLEKKDGNIAAVLDL 363 GF N G W +L+ K G I AV D+ Sbjct: 213 GFGNVGSWAAKLISDKGGKIVAVSDV 238 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,903,895 Number of Sequences: 28952 Number of extensions: 163133 Number of successful extensions: 424 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -