BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0947 (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0941 - 7423284-7423366,7423479-7423749,7423844-7423913,742... 34 0.11 03_03_0105 + 14491198-14493636,14494793-14494957,14495647-144957... 29 3.2 04_04_1397 - 33230416-33230742,33230852-33231007,33231130-332315... 28 5.6 02_01_0006 - 42752-43816 28 5.6 03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711,550... 28 7.4 07_03_1591 + 27967065-27967090,27967236-27968054,27984940-279850... 27 9.7 >01_01_0941 - 7423284-7423366,7423479-7423749,7423844-7423913, 7424034-7424329,7426097-7426642 Length = 421 Score = 33.9 bits (74), Expect = 0.11 Identities = 24/87 (27%), Positives = 42/87 (48%) Frame = +3 Query: 336 KQADIILSVETTESNAKTYKDIVVPLVSHLIDSLKSKHITDVKVFLVGHTSKYPYPIFMT 515 +Q + ET + T+ D V L++ + +L ++H + F V +Y + Sbjct: 303 QQVSFVNGFETLKGG--THVDYVTELITTHLMNLLNEHYEECN-FNVDDVKRYLWVFLNV 359 Query: 516 LTSN*KTPTYTSTTRNATITSPPSRLG 596 + N PT+ S T+ T+T+PP RLG Sbjct: 360 IIDN---PTFDSQTKE-TLTTPPGRLG 382 >03_03_0105 + 14491198-14493636,14494793-14494957,14495647-14495760, 14496223-14496487,14497164-14497237,14497851-14497928 Length = 1044 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 171 QTPLKICXXL*FRTXNGSSGAXRPSPCRLPNVCVK-CTDADKP 296 Q P K FRT +G+S + PS R N+CV D +P Sbjct: 108 QRPSKSFSETTFRTISGASVSANPSSARTGNLCVSLAADVQEP 150 >04_04_1397 - 33230416-33230742,33230852-33231007,33231130-33231543, 33234177-33234307,33235076-33235202,33235709-33236209, 33237624-33237935,33238690-33238719 Length = 665 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 450 CVYSLDCQSN-VTRAVPRYPCKSLHWIQLSQLIG 352 CV+ CQ + R++PR P L W+Q++ G Sbjct: 562 CVHQRYCQDDGELRSLPRCPHSHLSWVQITGFFG 595 >02_01_0006 - 42752-43816 Length = 354 Score = 28.3 bits (60), Expect = 5.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 18 SGDIPPKTCTMHPSPPP 68 +GD+P C HPS PP Sbjct: 86 NGDVPSSRCPKHPSQPP 102 >03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711, 5500940-5501029,5501147-5501464 Length = 566 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 345 DIILSVETTESNAKTYKDIVVPLVSHLIDSLKSKHITD 458 D I+ + TT+++ +D+ LVSH IDS+ SK TD Sbjct: 138 DSIIVLGTTKAHLPWSEDL--KLVSHCIDSIASKASTD 173 >07_03_1591 + 27967065-27967090,27967236-27968054,27984940-27985022, 27985590-27985744,27985956-27986461,27986551-27986703, 27987146-27987485,27987558-27987822,27987897-27988634, 27989734-27989779,27989849-27990223,27991511-27991567, 27991640-27992438 Length = 1453 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +2 Query: 2 GSGGSERRYSPEDLHDASLPPACDXVXXGITXLXXLCXVHXTXRSXRQACIHAVTGTDAA 181 G GG+ +PED+ A++ A D G+T +C H S AC+ VT Sbjct: 256 GEGGAVVLLAPEDIARAAVYLASDEASNGVTEDYLVC-FHNNEPS--NACVTPVTSEGVG 312 Query: 182 KD 187 D Sbjct: 313 GD 314 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,585,695 Number of Sequences: 37544 Number of extensions: 339599 Number of successful extensions: 1058 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -