BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0945 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39853-2|AAK39225.1| 771|Caenorhabditis elegans Kinase suppress... 29 2.9 U38820-1|AAA92436.1| 771|Caenorhabditis elegans KSR-1 protein. 29 2.9 S80647-1|AAB35769.1| 771|Caenorhabditis elegans KSR-1 protein. 29 2.9 Z69716-4|CAA93528.1| 480|Caenorhabditis elegans Hypothetical pr... 28 6.7 >U39853-2|AAK39225.1| 771|Caenorhabditis elegans Kinase suppressor of activatedras protein 1 protein. Length = 771 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 256 WNGTTLQFYNRNFNSPTPSVS-GRTGKIYQGWN 351 WN T+QF F+ P + GR GK+ +G++ Sbjct: 464 WNEVTIQFETIEFDKQAPIIGRGRFGKVLRGFH 496 >U38820-1|AAA92436.1| 771|Caenorhabditis elegans KSR-1 protein. Length = 771 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 256 WNGTTLQFYNRNFNSPTPSVS-GRTGKIYQGWN 351 WN T+QF F+ P + GR GK+ +G++ Sbjct: 464 WNEVTIQFETIEFDKQAPIIGRGRFGKVLRGFH 496 >S80647-1|AAB35769.1| 771|Caenorhabditis elegans KSR-1 protein. Length = 771 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 256 WNGTTLQFYNRNFNSPTPSVS-GRTGKIYQGWN 351 WN T+QF F+ P + GR GK+ +G++ Sbjct: 464 WNEVTIQFETIEFDKQAPIIGRGRFGKVLRGFH 496 >Z69716-4|CAA93528.1| 480|Caenorhabditis elegans Hypothetical protein C04B4.4 protein. Length = 480 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 21 KRRKKNECSHRWCVTGWST*RRLERNPDI 107 KRRK EC W GW+ +L+R PD+ Sbjct: 176 KRRKFIECRTHWFQIGWNDVVKLQR-PDV 203 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,387,172 Number of Sequences: 27780 Number of extensions: 260697 Number of successful extensions: 654 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -