BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0944 (644 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_44841| Best HMM Match : 7tm_1 (HMM E-Value=4.79999e-40) 50 2e-06 SB_39190| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_33545| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_1137| Best HMM Match : CC (HMM E-Value=2) 30 1.4 SB_38544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 5.7 SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) 28 5.7 SB_41146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) 28 5.7 SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 28 7.5 SB_55679| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_48646| Best HMM Match : Sulfotransfer_1 (HMM E-Value=8.5) 27 9.9 SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) 27 9.9 >SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 73.3 bits (172), Expect = 2e-13 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +2 Query: 86 SPPQWSPVYTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 235 +PP W YT+ G+L +PYAE+ EPF AW+D +SRIDYYGGM T+Q Sbjct: 337 TPPTWPQEYTLTGVLRLPYAEIEEPFQAWFDGGRKRSRIDYYGGMDSTFQ 386 Score = 69.3 bits (162), Expect = 2e-12 Identities = 33/96 (34%), Positives = 50/96 (52%) Frame = +1 Query: 199 NRLLWRYGQDLPVHVSGLPPYGTSIKIAPVTTETEMNKETCLQVNSTQDQLQDIQSVLPD 378 +R+ + G D + G + +I P++TET++N +C Q N T QSVLPD Sbjct: 373 SRIDYYGGMDSTFQRGDILTAGANFRICPMSTETKLNVRSCFQTNGTSASPVGPQSVLPD 432 Query: 379 MTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMW 486 + F ++G T D + W+ VG K NKYTM+ Sbjct: 433 LAKFSFVGNSTYGDVKCSIWEYKLTVGHKRNKYTMY 468 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 522 PIPVRYEMKGFNSLLGS 572 P P+ YEM GF+ L+GS Sbjct: 475 PAPIHYEMLGFDDLIGS 491 >SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 64.5 bits (150), Expect = 7e-11 Identities = 31/101 (30%), Positives = 52/101 (51%) Frame = +1 Query: 187 QQIENRLLWRYGQDLPVHVSGLPPYGTSIKIAPVTTETEMNKETCLQVNSTQDQLQDIQS 366 Q +R+ + YG D + + P+G + KI P+ T+ + C + T+ +Q Sbjct: 76 QHNRSRIDYYYGTDRTFQRADVGPHGEAFKIVPIYTDEKGGYIGCWHLEGTERTPIVVQP 135 Query: 367 VLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWV 489 ++P+MTDFK+ G E A TAKW+ +N +T+WV Sbjct: 136 IVPNMTDFKFAGYEVYHGASTAKWEYRYLAFGLMNAHTIWV 176 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = +2 Query: 80 KGSPPQWSPV-----YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 235 + +PP P Y G L +P++++ EPF W+ +++++SRIDYY G +T+Q Sbjct: 37 RSAPPPMKPFHFPRNYHATGKLQLPHSKIEEPFEVWFSAQHNRSRIDYYYGTDRTFQ 93 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +3 Query: 522 PIPVRYEMKGFNSLLGS 572 P PVRYEMKG+++LL S Sbjct: 182 PRPVRYEMKGYDNLLAS 198 >SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 57.6 bits (133), Expect = 8e-09 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = +2 Query: 110 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 235 Y G+L++PY ++ EPF WY + SRIDYYGGM +TYQ Sbjct: 39 YHATGVLSLPYGDIKEPFEVWYSGLHGMSRIDYYGGMDRTYQ 80 Score = 55.6 bits (128), Expect = 3e-08 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +2 Query: 110 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 235 Y G+L +P +E++EPF W+ +++SRIDYYGG VKTYQ Sbjct: 902 YHATGVLRLPTSEVNEPFEIWFSRPHNQSRIDYYGGDVKTYQ 943 >SB_44841| Best HMM Match : 7tm_1 (HMM E-Value=4.79999e-40) Length = 1198 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +2 Query: 110 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 235 Y G L++PY + EPF +WY + SRIDYY GM KT+Q Sbjct: 1020 YHAIGTLHLPYDNIREPFESWYARDYNMSRIDYYYGMDKTFQ 1061 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 110 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMV 223 Y V+G L++PY E+ EPF AWY + SRIDYY G V Sbjct: 878 YRVQGTLSLPYDEIVEPFEAWYAGDYNMSRIDYYYGKV 915 Score = 45.2 bits (102), Expect = 5e-05 Identities = 32/106 (30%), Positives = 47/106 (44%), Gaps = 5/106 (4%) Frame = +1 Query: 199 NRLLWRYGQDLPVHVSGLPPYGTSIKIAPVT--TETEMNKET--CLQVNSTQDQLQDIQS 366 +R+ + YG D L YG +K+ P + +++K T C + Q QS Sbjct: 1048 SRIDYYYGMDKTFQRGDLMDYGVLVKVVPAHWGRDEDLDKNTISCWYRPGFRWSQQRGQS 1107 Query: 367 VLP-DMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYKK 501 VLP + FK+IG E T K+Q + K N YT W+ K Sbjct: 1108 VLPAHLEHFKFIGEEIRSGMPTFKYQRNTTIFHKKNSYTFWMTKAK 1153 >SB_39190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = +2 Query: 110 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGG 217 Y V+G L++PY E+ EPF AWY + SRIDYY G Sbjct: 72 YRVQGTLSLPYDEIVEPFEAWYAGDYNMSRIDYYYG 107 >SB_33545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 180 VRTANRESITMEVWSRLTSSRQRSTALRYFYKDRAGHNGN*DEQGDVPAS-QFDARSAPR 356 +R +E E++S+LT++ Q STA+ ++A H G ++ P + + + R R Sbjct: 2 LRAHYQEKSATELYSQLTTAVQASTAINALKGEKASHCGRAEKGSGFPLNYRQNIRDFSR 61 Query: 357 HPISATGY 380 H S T Y Sbjct: 62 HAKSLTTY 69 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 31.5 bits (68), Expect = 0.61 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 274 KIAPVTTETEMNKETCLQVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTA 432 K++PV T+ E ++ + Q +++DI ++ D+ D KY ADT+ Sbjct: 4087 KLSPVGTDVETIEQQMDDLKELQKEVEDIDELIADLNDQKYRVALQNPTADTS 4139 >SB_1137| Best HMM Match : CC (HMM E-Value=2) Length = 410 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = +1 Query: 226 DLPVHVSGLPPYGTSIKIAP---VTTETEMNKETCLQVNSTQDQLQDIQSVLP-DMTDFK 393 D + L G KI P V T ++ N +C + QSV+P ++T+FK Sbjct: 184 DKTIQRGDLGANGMLFKIVPMHYVVTPSDKNIISCWYKPLATWLPRAGQSVVPTNLTEFK 243 Query: 394 YIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYKK 501 + ET + + ++Q +K N Y +W+ K Sbjct: 244 MVAIETHRGHPSFRFQRKFSELNKTNTYILWITTHK 279 >SB_38544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 935 Score = 29.5 bits (63), Expect = 2.4 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -1 Query: 527 YGHRIPFKVFLYLTHIVYLFSLSPTGCTICHLAVSASCIVSVPIYLKSVIS--GSTDWMS 354 + + IP+ + HI+ ++SP G T C ++ S+ + + I L+ +S G T Sbjct: 25 WSYNIPWSHNMPCLHIILQHAVSPHGLTTCRVSTSSYNMSCLHIILQHAVSPHGLTT-CR 83 Query: 353 WS*SCVELTCRHVSLFISVS 294 S S + C H+ L +VS Sbjct: 84 VSTSSYNMPCLHMVLQHAVS 103 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 77 DKGSPPQWSPVYTVKGLLNI 136 DKGSPPQ+S + + +LNI Sbjct: 451 DKGSPPQYSEITVIVKVLNI 470 >SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) Length = 317 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 325 QVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQM--VQPVGDKLNKYTMWV 489 Q T + QD +S ++D KYIG + + T +W + +P +L+ + WV Sbjct: 153 QEGYTGELCQDCKSPPIGISDEKYIGNSRIAGSSTGQWVLDYFEPYKGRLHGPSSWV 209 >SB_41146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 5.7 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 6/81 (7%) Frame = +1 Query: 217 YGQDLPVHVSGLPPYGTSI----KIAPVTTETEMNKETCLQVNSTQDQLQDIQSVLPDMT 384 Y ++P HVSGLP + + +T ++E + ++V + Q L++I+ LP + Sbjct: 296 YSANVPGHVSGLPMSVSHLPHDDDQCVMTEKSESIEANIIRVTTLQLDLEEIKKDLPKIL 355 Query: 385 DFKYIG--TETMQDADTAKWQ 441 G TE D +T + Q Sbjct: 356 VKSVFGWVTEVCPDEETERDQ 376 >SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 1250 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 244 SGLPPYGTSIKIAPVTTETEMNKETCLQVNSTQDQLQDIQSVLPDMTD 387 SG P ++ ++ ++ T + T + S LQD +S+LPD++D Sbjct: 680 SGSPSPNATLDLSDLSRRTSLYSTTTVSFGS---DLQDTESLLPDLSD 724 >SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 1053 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = -3 Query: 591 DSNDRSGSPGAN*NLSSHIGPVWAQNPL--QSLLVFNPHRVFV*LIAD 454 D++ R+G G + N H+GP + NPL LL F HRV L+AD Sbjct: 287 DASARTGKKGVSFNDCLHVGP--SLNPLLFNVLLKFRLHRVA--LVAD 330 >SB_55679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 232 PVHVSGLPPYGTSIKIAPVTTET 300 PVH+S +P Y SI + P+TT + Sbjct: 93 PVHLSTIPYYIQSISVPPLTTSS 115 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 244 SGLPPYGTSIKIAPVTTET--EMNKETCLQVNSTQDQLQDIQSVLPDM 381 SG+P G SIK +P+ T+ + + Q +L+D Q + DM Sbjct: 39 SGIPSPGNSIKKSPIPTQRIGSIASSVTKDYDELQQKLKDQQKYIADM 86 >SB_48646| Best HMM Match : Sulfotransfer_1 (HMM E-Value=8.5) Length = 674 Score = 27.5 bits (58), Expect = 9.9 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -3 Query: 546 SSHIGPVWAQNPLQSLLVFNPHRVFV*LIA---DRLYHLPFGRVGILHCFCADIFKIG-H 379 + H G V A P + LLVFNP + L A + +P+ RV + IFK H Sbjct: 583 TKHNGDVMANIPAKQLLVFNPKDGWEPLCAFLGAEVPAIPYPRVNVNSTAIPSIFKNSWH 642 Query: 378 IR 373 +R Sbjct: 643 VR 644 >SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) Length = 1033 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 389 LNISAQKQCRMPTRPNGRWYSRSAIS 466 L+ S++ CR PTRP R++S +A+S Sbjct: 34 LDESSRDVCRFPTRPLIRYFSFTALS 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,500,476 Number of Sequences: 59808 Number of extensions: 433694 Number of successful extensions: 1324 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -