BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0941 (646 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 29 0.025 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 5.0 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 5.0 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 8.7 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 29.5 bits (63), Expect = 0.025 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = -1 Query: 262 SVGAFQDIIYYIIRSNCNCIVHASKTTSCKYFMAFVGKNICFIRSTLSRDVSA 104 +V A D +YY R++ +C V + + + KY F G++ + L R++S+ Sbjct: 77 AVEAGFDWVYYESRAHIHCSVKSESSQAAKYGGCFSGESTVLTSTGLRRNLSS 129 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.8 bits (44), Expect = 5.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 173 FATRGFRSMYNAIAIRSYNVIYNVLKS 253 F GFR Y + RSY +I VL S Sbjct: 130 FIKAGFRLEYKQLLKRSYLIISFVLFS 156 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.8 bits (44), Expect = 5.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 173 FATRGFRSMYNAIAIRSYNVIYNVLKS 253 F GFR Y + RSY +I VL S Sbjct: 130 FIKAGFRLEYKQLLKRSYLIISFVLFS 156 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -1 Query: 232 YIIRSNCNCIVHASKTTSCKY 170 Y R NCI+ + C+Y Sbjct: 120 YACREEKNCIIDKRQRNRCQY 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,233 Number of Sequences: 336 Number of extensions: 2323 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -