BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0941 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80437-18|AAB37629.1| 518|Caenorhabditis elegans Cell division ... 29 3.7 U28735-10|AAM69112.1| 2427|Caenorhabditis elegans Hypothetical p... 28 4.9 >U80437-18|AAB37629.1| 518|Caenorhabditis elegans Cell division cycle related protein6 protein. Length = 518 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 597 RRRVVAEESKSPGLPITGIRSLIRLIFEHDLTPLQNVGL 481 + R++ ++SK PG P+ G R ++ +I +PL L Sbjct: 384 KSRMIPDDSKVPGTPVNGCREVLGIINNVYSSPLARARL 422 >U28735-10|AAM69112.1| 2427|Caenorhabditis elegans Hypothetical protein F48E3.8a protein. Length = 2427 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 209 LHCTCF*NHELQIFHGVCRQKHLFYKVNPIKGCKCVQP 96 +H CF E +F G C++ + K+ ++ K ++P Sbjct: 1005 VHGICFCKEEFTLFEGKCQRLRIIEKLTVLESKKLIKP 1042 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,105,385 Number of Sequences: 27780 Number of extensions: 212104 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -