BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0939 (641 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC060865-1|AAH60865.1| 599|Homo sapiens zinc finger protein 530... 30 8.0 AC003682-5|AAC24609.1| 557|Homo sapiens R28830_2 protein. 30 8.0 AB040941-1|BAA96032.1| 573|Homo sapiens KIAA1508 protein protein. 30 8.0 >BC060865-1|AAH60865.1| 599|Homo sapiens zinc finger protein 530 protein. Length = 599 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 163 SSCXQYCRPSDSSFENRRCEARSKQKVCSQCTNPENNEASIESSHHTVDIGLDRPIE 333 S C + S F +RR ++K CS+C + + + H TV G +RP E Sbjct: 438 SECGKVFSQSSGLFRHRRAHTKTKPYECSECEKSFSCKTDL-IRHQTVHTG-ERPYE 492 >AC003682-5|AAC24609.1| 557|Homo sapiens R28830_2 protein. Length = 557 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 163 SSCXQYCRPSDSSFENRRCEARSKQKVCSQCTNPENNEASIESSHHTVDIGLDRPIE 333 S C + S F +RR ++K CS+C + + + H TV G +RP E Sbjct: 396 SECGKVFSQSSGLFRHRRAHTKTKPYECSECEKSFSCKTDL-IRHQTVHTG-ERPYE 450 >AB040941-1|BAA96032.1| 573|Homo sapiens KIAA1508 protein protein. Length = 573 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 163 SSCXQYCRPSDSSFENRRCEARSKQKVCSQCTNPENNEASIESSHHTVDIGLDRPIE 333 S C + S F +RR ++K CS+C + + + H TV G +RP E Sbjct: 412 SECGKVFSQSSGLFRHRRAHTKTKPYECSECEKSFSCKTDL-IRHQTVHTG-ERPYE 466 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,197,081 Number of Sequences: 237096 Number of extensions: 1826131 Number of successful extensions: 4684 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4684 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7085195460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -