BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0938 (400 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 0.77 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 5.4 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 25.4 bits (53), Expect = 0.77 Identities = 13/44 (29%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 131 IHNTGTAPTRXSXLCPRLCKK*KDR--SDSKIHQAVNGVRATRC 6 IH G P LCP C + D +H A ++ RC Sbjct: 289 IHQVGNKPVFQCKLCPTTCGRKTDLRIHVQNLHTADKPIKCKRC 332 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 227 SFRMTPQXERRXRAGSRSPTPSKT 298 SFR +RR R +++PT S T Sbjct: 243 SFRSLSMHKRRTRKQNKNPTHSST 266 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 319,085 Number of Sequences: 2352 Number of extensions: 3906 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -