Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0938
         (400 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g14190.1 68414.m01679 glucose-methanol-choline (GMC) oxidored...    27   6.1  

>At1g14190.1 68414.m01679 glucose-methanol-choline (GMC)
           oxidoreductase family protein similar to mandelonitrile
           lyase from Prunus serotina [SP|P52706, SP|P52707];
           contains Pfam profile PF00732 GMC oxidoreductase
          Length = 501

 Score = 26.6 bits (56), Expect = 6.1
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = -2

Query: 333 AAGSVRGGPKHVVFEGVGDLDPARXLRSSCGVILKDKSGVMMKNPDINIIID 178
           AAG++ G P+ ++  G+G  +  +       V LK+    M  NP I++++D
Sbjct: 247 AAGAL-GSPQILLLSGIGPENHLKDFDIPVIVNLKEVGRKMSDNPAISLLVD 297


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,649,167
Number of Sequences: 28952
Number of extensions: 93787
Number of successful extensions: 166
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 164
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 166
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 575830496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)