BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0935 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.9 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 8.7 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.7 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 584 SNSDTGVPTMRLRPSTTTFLPAIVTRSS*SVPRT 483 S++ + +PT R S T+ V S SVP T Sbjct: 78 SSTPSSLPTQRTSTSNPTYSSRSVMTSCSSVPTT 111 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 398 KDVDGLNTINEGRVAVGDLSGFIPCTPAGCVEL 496 KD+ I ++V DL + CTP VE+ Sbjct: 97 KDMRNSTNIFLVNLSVADLMVLLVCTPTVLVEV 129 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 398 KDVDGLNTINEGRVAVGDLSGFIPCTPAGCVEL 496 KD+ I ++V DL + CTP VE+ Sbjct: 97 KDMRNSTNIFLVNLSVADLMVLLVCTPTVLVEV 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,263 Number of Sequences: 336 Number of extensions: 2899 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -