BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0935 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21968| Best HMM Match : THF_DHG_CYH (HMM E-Value=0.0018) 90 1e-18 SB_18696| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0) 33 0.26 SB_24382| Best HMM Match : F5_F8_type_C (HMM E-Value=4.90006e-41) 32 0.35 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 32 0.46 SB_22310| Best HMM Match : Exo_endo_phos (HMM E-Value=0.12) 31 0.81 SB_56787| Best HMM Match : Keratin_B2 (HMM E-Value=0.34) 27 1.8 SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) 29 2.5 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 29 2.5 SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 29 2.5 SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) 29 2.5 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_5745| Best HMM Match : Extensin_2 (HMM E-Value=0.43) 29 4.3 SB_48254| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 29 4.3 SB_1962| Best HMM Match : Leu_leader (HMM E-Value=5.2) 29 4.3 SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56472| Best HMM Match : Transposase_5 (HMM E-Value=1.2) 28 5.7 SB_44251| Best HMM Match : Transposase_5 (HMM E-Value=0.072) 28 5.7 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) 28 5.7 SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) 28 7.5 SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) 28 7.5 SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) 28 7.5 SB_2592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_34670| Best HMM Match : Tctex-1 (HMM E-Value=0.0027) 28 7.5 SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_523| Best HMM Match : zf-C2H2 (HMM E-Value=4.9) 27 9.9 >SB_21968| Best HMM Match : THF_DHG_CYH (HMM E-Value=0.0018) Length = 101 Score = 90.2 bits (214), Expect = 1e-18 Identities = 41/84 (48%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = +2 Query: 260 ITEIELLAKITSLNESPSVHGIIVQMPLDSDHAIDAHRVTDAVSPDKDVDGLNTINEGRV 439 + ++++L + LN+ ++HGIIVQ+P DS++ ID T+AV P+KDVDGL+ N GR+ Sbjct: 17 LCDMQVLKAVDELNKDSAIHGIIVQLPPDSENPIDPGICTNAVIPEKDVDGLHDENAGRL 76 Query: 440 AVGDLSG-FIPCTPAGCVELIKKT 508 A G+L+ +PCTP GC+ELIKK+ Sbjct: 77 ARGELATCIVPCTPRGCLELIKKS 100 >SB_18696| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0) Length = 119 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +1 Query: 595 HATVTVCHSKTKNLSEI 645 +ATVT+CHS+TKNL E+ Sbjct: 13 NATVTICHSRTKNLKEM 29 >SB_24382| Best HMM Match : F5_F8_type_C (HMM E-Value=4.90006e-41) Length = 316 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 146 PGLEARPF*TQPRHLLTQVIFYRSCNFNPRYNLCHLSPENCLV 18 P L RPF T+ R + +Q +F R + RY C L +CL+ Sbjct: 21 PPLFTRPFFTRIRTIYSQPVFIRRTLMDNRYRSCLLKGFSCLI 63 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 31.9 bits (69), Expect = 0.46 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 481 RVRGTD*EDRVTIAGKNVVVLGRSRIVGTPVSELLKWEH 597 ++R +TI KN+ + +SR++G ++E L W+H Sbjct: 134 KLRNLPCHPNITIDDKNIKQIRQSRVLGIEINEHLNWDH 172 >SB_22310| Best HMM Match : Exo_endo_phos (HMM E-Value=0.12) Length = 633 Score = 31.1 bits (67), Expect = 0.81 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -2 Query: 519 YSDAVFLISSTHPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASV 376 +S+ VFL + THP G++G+ P + +F+ S+S GE+A V Sbjct: 72 WSNCVFLETLTHPHGLKGVRYIEVPQTY--LVPIFRKSSSFKGESAMV 117 >SB_56787| Best HMM Match : Keratin_B2 (HMM E-Value=0.34) Length = 527 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 511 VTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHS 621 +T ++V + RSR GT +S ++ TVT CH+ Sbjct: 358 ITSRSRHVTITSRSRH-GTIISRSRHHDNITVTTCHN 393 Score = 21.8 bits (44), Expect(2) = 1.8 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +1 Query: 595 HATVTVCHSK---TKNLSEIT 648 H TVT CH+ TK L+ IT Sbjct: 421 HITVTTCHNHTTVTKCLNHIT 441 >SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) Length = 360 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNL 636 D +TI GK + V+ ++++G +S+ L W V +K L Sbjct: 122 DAITIEGKELEVVKSTKLLGLTISDNLSWNAHVNEVVKKSSKKL 165 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNL 636 D +TI GK + V+ ++++G +S+ L W V +K L Sbjct: 540 DAITIEGKELEVVKSTKLLGLTISDNLSWNAHVNEVVKKSSKKL 583 >SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNL 636 D +TI GK + V+ ++++G +S+ L W V +K L Sbjct: 388 DAITIEGKELEVVKSTKLLGLTISDNLSWNAHVNEVVKKSSKKL 431 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNL 636 D +TI GK + V+ ++++G +S+ L W V +K L Sbjct: 458 DAITIEGKELEVVKSTKLLGLTISDNLSWNAHVNEVVKKSSKKL 501 >SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1482 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = +2 Query: 260 ITEIELLAKITSLNESPSVHGIIVQMPLD---SDHAIDAHRVTDAVSPDKDVDGLNTINE 430 + +++++ +T L++ V G+ + +D D +D V D+V+ DVDG+ +++ Sbjct: 497 LDDVDVVEDVTLLDDVDVVDGVTLLDDVDVVDGDPLLDDVDVVDSVAELDDVDGVTLLDD 556 Query: 431 GRVAVGD 451 V GD Sbjct: 557 VDVVDGD 563 >SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) Length = 379 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKWEHATVTVCHSKTKNL 636 D +TI GK + V+ ++++G +S+ L W V +K L Sbjct: 195 DAITIEGKELEVVKSTKLLGLTISDNLSWNAHVNEVVKKSSKKL 238 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -2 Query: 549 PPEHYHIFA---SYSDAVFLISSTHPAGVQGMNPDRSPTATRPS 427 P HY +FA SY+D + ++ +G G+NP PT PS Sbjct: 313 PTTHYTVFARVASYTDWIKRMTVVGTSGGGGVNPPPPPTNNPPS 356 >SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1525 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 486 HPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASVTR*ASIA-WSES 343 HP G+ + D +PT+TR S++ K +T LS +TR I W+++ Sbjct: 258 HPEGLVLICGDFNPTSTRFSVVATKRATGLSQIVKVLTRDTGILDWAKT 306 >SB_5745| Best HMM Match : Extensin_2 (HMM E-Value=0.43) Length = 607 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = -2 Query: 570 RSTHDATPPEHYHIFASYSDAVFLISSTHPAGVQGMNPDRSPTATRPSLIVFKPSTSLSG 391 R AT ++ + + V ++HP + + D +P +T+ SL+VF + LS Sbjct: 503 RGKKAATAKDNDNFYNYVQSVVDDYQASHPDCLVCVTRDFNPNSTKISLVVFNRACGLSQ 562 Query: 390 ETASVTR 370 T +TR Sbjct: 563 ITKVLTR 569 >SB_48254| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 1414 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -2 Query: 555 ATPPEHYHIFASYSDAVFLISSTHPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASV 376 AT ++ ++ V S++HP + D +P AT S +VFK S L+ T + Sbjct: 800 ATGADNNDLYNHVQVTVDAYSASHPECLVCAAGDFNPNATNISPVVFKRSCGLTQITKVL 859 Query: 375 TR 370 TR Sbjct: 860 TR 861 >SB_1962| Best HMM Match : Leu_leader (HMM E-Value=5.2) Length = 140 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 457 RIHSLHSGRVRGTD*EDRVTIAGKNVVVLGRSRIVGTPVSELLKWE 594 R+HSL SGR V+ + KN+ + +I+G +SE LKW+ Sbjct: 68 RVHSLDSGR-------PVVSTSDKNLDYVSVYKILGVNISEHLKWD 106 >SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1001 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 486 HPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASVTR 370 HP G+ + D +PT+TR S++ K +T LS +TR Sbjct: 883 HPEGLVLICGDFNPTSTRFSVVATKRATGLSQIVKVLTR 921 >SB_56472| Best HMM Match : Transposase_5 (HMM E-Value=1.2) Length = 615 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 280 SKNHESERISFRSRHHCSNAP 342 +K+++S +I FR R HC N P Sbjct: 63 TKSYQSVQIQFRKRFHCRNFP 83 >SB_44251| Best HMM Match : Transposase_5 (HMM E-Value=0.072) Length = 221 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 280 SKNHESERISFRSRHHCSNAP 342 +K+++S I FR R HC N P Sbjct: 18 TKSYQSAHIQFRKRFHCRNFP 38 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 486 HPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASVTR 370 HP G+ + D +PT+TR S++ K +T LS +TR Sbjct: 260 HPEGLVLICGDFNPTSTRFSVVATKRATGLSQIVKVLTR 298 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 93 LRQQVTRLRSKWSGFEPRLAIVQVGGREDS 182 +RQ V + SK+ G PR AI Q+GG D+ Sbjct: 597 VRQPVNDVTSKYPG-SPRNAIAQIGGSRDA 625 >SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) Length = 731 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 486 HPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASVTR 370 HP G+ + D +PT+TR S++ K +T LS +TR Sbjct: 534 HPEGLVLICGDFNPTSTRFSVVATKRATGLSQIVKVLTR 572 >SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) Length = 194 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 505 DRVTIAGKNVVVLGRSRIVGTPVSELLKW 591 D +TI GK + V+ ++++G +S+ L W Sbjct: 13 DAITIEGKELEVVKSTKLLGLTISDNLSW 41 >SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) Length = 302 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 486 HPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASVTR 370 HP G+ + D +PT+TR S++ K +T LS +TR Sbjct: 151 HPEGLVLICGDFNPTSTRFSVVATKRATCLSQIAKVLTR 189 >SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) Length = 842 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 39 KMAQIISGIEVAGSIENDLRQQVTRLRSKWSGFEPRLAIVQ 161 K A + +G +AG I++ + +QVTR + +GF L + Q Sbjct: 2 KKAAVAAGASIAGHIKHAIAEQVTRAK---TGFPRSLTLAQ 39 >SB_2592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 137 EARPF*TQPRHLLTQV---IFYRSCNFNPRYNLCHL 39 +ARP P L T+ + Y +C+ +P +NLC L Sbjct: 123 DARPLLLHPNKLFTKRRGRVSYYNCSTSPSFNLCEL 158 >SB_34670| Best HMM Match : Tctex-1 (HMM E-Value=0.0027) Length = 471 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = -3 Query: 593 SHFSNSDTGVPTMRLRPSTTTFLPAIV 513 S F++S+TGVP++RLR ++ + A+V Sbjct: 219 STFNSSNTGVPSIRLRRASNPPITALV 245 >SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = -2 Query: 555 ATPPEHYHIFASYSDAVFLISSTHPAGVQGMNPDRSPTATRPSLIVFKPSTSLSGETASV 376 A+ ++ +++ + V +HP + + D +PT+T+ S + FK S L+ + Sbjct: 28 ASAEDNNMLYSHVQETVDRFLRSHPEALVCVTGDFNPTSTKISPVPFKRSAGLTQTVNVL 87 Query: 375 TR 370 TR Sbjct: 88 TR 89 >SB_523| Best HMM Match : zf-C2H2 (HMM E-Value=4.9) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +2 Query: 341 LDSDHAIDAHRVTDAVSPDKDVDGLNTINEGRVAVGDLSGFIPC---TPAGCVELIKKTA 511 L + A + V D V P+ +V + EG+ V SG+ P +GC +L Sbjct: 73 LSAKLAASRNHVRDHVQPEDEVFSKPRVKEGKNRVKSPSGYSPVDMFVCSGCDKLYNSQK 132 Query: 512 SL*LAKMW*CSGGV 553 L + K + C G V Sbjct: 133 DLDIQKSF-CYGNV 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,770,585 Number of Sequences: 59808 Number of extensions: 392791 Number of successful extensions: 941 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -