BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0931 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46787-16|CAO78703.1| 821|Caenorhabditis elegans Hypothetical p... 30 0.81 Z35596-2|CAO78713.1| 821|Caenorhabditis elegans Hypothetical pr... 30 0.81 U39650-4|AAK39186.1| 944|Caenorhabditis elegans Apical junction... 28 4.3 U39650-3|AAK39188.1| 1148|Caenorhabditis elegans Apical junction... 28 4.3 U39650-2|AAM51517.1| 1439|Caenorhabditis elegans Apical junction... 28 4.3 U39650-1|AAK39187.1| 1480|Caenorhabditis elegans Apical junction... 28 4.3 >Z46787-16|CAO78703.1| 821|Caenorhabditis elegans Hypothetical protein C30D11.1b protein. Length = 821 Score = 30.3 bits (65), Expect = 0.81 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -2 Query: 191 NLTRDRFVTAREKKYNLGRARVRE*TERLANHSTVERGRRQTQLGRXSYTQHSLLH 24 +LTR R +TA K + V+ E L NH T R+ + L + + HS H Sbjct: 14 DLTRHRKLTADAKAVSPSSCSVKFMPEVLDNHGTTTSARKHSSLSQPALRCHSKQH 69 >Z35596-2|CAO78713.1| 821|Caenorhabditis elegans Hypothetical protein C30D11.1b protein. Length = 821 Score = 30.3 bits (65), Expect = 0.81 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -2 Query: 191 NLTRDRFVTAREKKYNLGRARVRE*TERLANHSTVERGRRQTQLGRXSYTQHSLLH 24 +LTR R +TA K + V+ E L NH T R+ + L + + HS H Sbjct: 14 DLTRHRKLTADAKAVSPSSCSVKFMPEVLDNHGTTTSARKHSSLSQPALRCHSKQH 69 >U39650-4|AAK39186.1| 944|Caenorhabditis elegans Apical junction molecule protein1, isoform b protein. Length = 944 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 162 QREKIQFRTSESERIDRASREPLDRGEREK 73 +RE+ + E ERI+R RE ++R RE+ Sbjct: 416 ERERREHERIEIERIERIKRERIERERRER 445 >U39650-3|AAK39188.1| 1148|Caenorhabditis elegans Apical junction molecule protein1, isoform c protein. Length = 1148 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 162 QREKIQFRTSESERIDRASREPLDRGEREK 73 +RE+ + E ERI+R RE ++R RE+ Sbjct: 416 ERERREHERIEIERIERIKRERIERERRER 445 >U39650-2|AAM51517.1| 1439|Caenorhabditis elegans Apical junction molecule protein1, isoform d protein. Length = 1439 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 162 QREKIQFRTSESERIDRASREPLDRGEREK 73 +RE+ + E ERI+R RE ++R RE+ Sbjct: 416 ERERREHERIEIERIERIKRERIERERRER 445 >U39650-1|AAK39187.1| 1480|Caenorhabditis elegans Apical junction molecule protein1, isoform a protein. Length = 1480 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 162 QREKIQFRTSESERIDRASREPLDRGEREK 73 +RE+ + E ERI+R RE ++R RE+ Sbjct: 416 ERERREHERIEIERIERIKRERIERERRER 445 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,144,410 Number of Sequences: 27780 Number of extensions: 149698 Number of successful extensions: 339 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -