BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0929 (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 29 0.12 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 28 0.27 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 27 0.35 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 26 0.82 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 26 1.1 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 26 1.1 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 1.4 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 1.4 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 2.5 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 24 4.4 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 5.8 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 5.8 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 5.8 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 7.6 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 7.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 7.6 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 29.1 bits (62), Expect = 0.12 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 6/75 (8%) Frame = +2 Query: 35 MFVYLIFIASF-FLLIHLAFNYNSKAVMMNKVPGPKLSFILGNAPEIMMLS---SVELMK 202 MFV + + S +L I+L FN + + +VP + SF GN P+ + + + + K Sbjct: 1 MFVQFLLVVSLGWLWIYLHFNQRYRFWVERQVPFLEPSFPAGNVPDTLKPTIHFAYIIEK 60 Query: 203 LGRKFASRWD--GIY 241 L ++ S+ D GIY Sbjct: 61 LYKRLKSKGDYVGIY 75 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 27.9 bits (59), Expect = 0.27 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 388 GEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVES 498 G++W+ R L+P F + +RQ +I E S +V++ Sbjct: 130 GQRWRNVRTTLSPTFTGSKMRQMFAMILECSDNMVQA 166 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 27.5 bits (58), Expect = 0.35 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 370 GLLISKGEKWQQRRKILTP 426 GL+ ++GE WQQ R I+ P Sbjct: 141 GLITTQGETWQQLRTIVNP 159 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVESWRND 510 P G L + +W+ R IL+PAF + +R +I V + R++ Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSE 53 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVESWRND 510 P G L + +W+ R IL+PAF + +R +I V + R++ Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSE 53 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVESWRND 510 P G L + +W+ R IL+PAF + +R +I V + R++ Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSE 53 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVESWRND 510 P G L + +W+ R IL+PAF + +R +I V + R++ Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSE 53 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 26.2 bits (55), Expect = 0.82 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 370 GLLISKGEKWQQRRKILTP 426 GL+ GEKWQ+ R I+ P Sbjct: 144 GLVTEHGEKWQKVRTIVNP 162 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 26.2 bits (55), Expect = 0.82 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 370 GLLISKGEKWQQRRKILTP 426 GL+ S+GE W++ R+I P Sbjct: 137 GLVTSQGESWRKMRRICNP 155 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVESWRND 510 P G L + +W+ R IL+PAF + +R +I V + R++ Sbjct: 122 PLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSE 173 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAF 432 P G L + +W+ R IL+PAF Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 355 PWLGDGLLISKGEKWQQRRKILTPAF 432 P G L + +W+ R IL+PAF Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 370 GLLISKGEKWQQRRKILTP-AFHFNILRQF 456 GLL +GE W + R I+ P ++RQ+ Sbjct: 141 GLLAEQGEDWHKMRTIVNPIMMQPKVIRQY 170 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 361 LGDGLLISKGEKWQQRRKILTPAFHFNILR-QFSVIIE 471 L L +G KW++ R LTP F L+ F I++ Sbjct: 115 LSANLFFMEGAKWRKLRSKLTPTFTSGKLKAMFHTIVD 152 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.6 bits (51), Expect = 2.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 59 ASFFLLIHLAFNYNSKAVMMNKVPGPKLSF 148 ++ FLL++ ++ MN+VP P SF Sbjct: 958 STLFLLVNGKISHGELLHRMNRVPSPSCSF 987 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +1 Query: 457 SVIIEENSXRLVESWRNDRKTY 522 S+++ EN ++ S+ ND++TY Sbjct: 491 SLVLGENVYAILRSFPNDKRTY 512 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 388 GEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVE 495 G++W+ R LTP F LR + + +L++ Sbjct: 119 GQRWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLID 154 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 361 LGDGLLISKGEKWQQRRKILTPAFHFNILRQ 453 L L +G +W+ R+ LTP F ++Q Sbjct: 118 LSGNLFALEGHEWRALRQKLTPTFTSGRMKQ 148 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 388 GEKWQQRRKILTPAFHFNILRQFSVIIEENSXRLVE 495 G++W+ R LTP F LR + + +L++ Sbjct: 119 GQRWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLID 154 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.0 bits (47), Expect = 7.6 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 385 KGEKWQQRRKILTPAFHFNILR-QFSVII 468 +G+KW+ R L+P F ++ FS I+ Sbjct: 64 EGQKWKNLRNKLSPTFTSGKMKMMFSTIV 92 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.0 bits (47), Expect = 7.6 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 361 LGDGLLISKGEKWQQRRKILTPAFHFNILR-QFSVIIE 471 L L GE+W+ R L+P F ++ FS I E Sbjct: 117 LSGHLFALDGERWRYLRNKLSPTFTSGKIKLMFSTICE 154 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 541 YYRYYVYRFSDHFSKIPPN 485 YY+ Y + F D+FS+ N Sbjct: 973 YYKQYPHLFKDYFSQYNKN 991 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,332 Number of Sequences: 2352 Number of extensions: 13472 Number of successful extensions: 52 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -