BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0927 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 27 0.38 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 25 1.5 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 25 1.5 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 25 2.7 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 25 2.7 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 3.5 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 24 4.7 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 8.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 8.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 8.2 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 8.2 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 27.5 bits (58), Expect = 0.38 Identities = 18/71 (25%), Positives = 31/71 (43%) Frame = -3 Query: 225 CKVFTRPPSISGALVMSDTS*TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETL 46 C+V PP+++ + T+ T A S +NC+ + RLF + + V Sbjct: 286 CEVAVEPPAMTTTTTTTTTTPTTATACPSTTEFNYKELNCQ-NCGRLFISNNGRVSCCRC 344 Query: 45 RRASFPFDAMF 13 ++S PF F Sbjct: 345 MKSSTPFGKFF 355 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = -3 Query: 162 TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETLRRASFPFDAMFC 10 TVR + RS VPP R+F+NE + E +F +AM C Sbjct: 159 TVRRSSRSTKGVPPQRFRETTGMVRIFSNERILITQEYCEPRTFE-EAMSC 208 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = -3 Query: 162 TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETLRRASFPFDAMFC 10 TVR + RS VPP R+F+NE + E +F +AM C Sbjct: 165 TVRRSSRSTKGVPPQRFRETTGMVRIFSNERILITQEYCEPRTFE-EAMSC 214 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = -3 Query: 162 TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETLRRASFPFDAMFC 10 TVR + RS VPP R+F NE + E +F +AM C Sbjct: 389 TVRRSSRSTKGVPPQRFRETTGMVRIFLNERILITQEYCEPRTFE-EAMSC 438 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = -3 Query: 162 TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETLRRASFPFDAMFC 10 TVR + RS VPP R+F NE + E +F +AM C Sbjct: 159 TVRRSSRSTKGVPPQRFRETTGMVRIFLNERILITQEYCEPRTFE-EAMSC 208 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 3.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 67 STLVSKESVGMWP-AVDRQWRYRHGASERRPDSSRCV 174 S + + +W A DRQW R AS +RP + R V Sbjct: 787 SEAIIRYGAPIWAEATDRQWCQRMLASFQRPLAQRVV 823 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 162 TVRPAFRSAVAVPPLAINCRPHSDRLFANESRPVLSETLRRA 37 T RPA+ A+ L CR R A+ + P +S R+A Sbjct: 290 TGRPAYWCTPAIEELENECRIAEQRQLASPTDPDISALDRQA 331 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 496 RTNITDVFRHKAEISPEXVH 555 R NITDV + + I+ E VH Sbjct: 333 RQNITDVMKQHSSITYEAVH 352 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 6.2 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -1 Query: 134 WRYRHWRSTAGHIPTDSLLTRVDPFCPKR*EELVFHLT 21 W+ R W +T T L+ + P+ +R + FH++ Sbjct: 859 WQ-REWSTTTSGSWTRRLIPNIQPWITRRHGNIEFHMS 895 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 221 LHPAVHAGILAHYQ 262 LHPA H G+ +YQ Sbjct: 188 LHPAYHTGLHHYYQ 201 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 221 LHPAVHAGILAHYQ 262 LHPA H G+ +YQ Sbjct: 188 LHPAYHTGLHHYYQ 201 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 248 LAHYQTLTRKT*NVRSTR 301 L H TL+RKT NV TR Sbjct: 1103 LGHRLTLSRKTLNVLDTR 1120 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 173 THLELSGRRSEAPWRYRHWRSTAGHI 96 THLE +G S+ + +R RST I Sbjct: 513 THLESTGGLSDPQYGFRKGRSTVDAI 538 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,867 Number of Sequences: 2352 Number of extensions: 11763 Number of successful extensions: 37 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -