BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0925 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 121 6e-28 SB_57127| Best HMM Match : MGS (HMM E-Value=0.25) 70 2e-12 SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 30 1.4 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 30 1.8 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 29 3.2 SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_26612| Best HMM Match : NC (HMM E-Value=6.7) 29 4.2 SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50503| Best HMM Match : DUF1661 (HMM E-Value=5.8) 27 9.7 SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 27 9.7 SB_25530| Best HMM Match : DUF1661 (HMM E-Value=5.8) 27 9.7 SB_18494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_17642| Best HMM Match : DUF1128 (HMM E-Value=0.92) 27 9.7 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_47644| Best HMM Match : Ldh_1_C (HMM E-Value=4.8) 27 9.7 SB_42065| Best HMM Match : DUF1661 (HMM E-Value=5.8) 27 9.7 SB_14380| Best HMM Match : DUF1661 (HMM E-Value=5.8) 27 9.7 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 121 bits (291), Expect = 6e-28 Identities = 57/82 (69%), Positives = 69/82 (84%) Frame = +2 Query: 8 GKLALLSVSDKTGLLSLAKSLSECGLQLIASGGTATALRNAGLTVQDVSDITXAPEMLGG 187 G LALLSVS+K GL+ AK L + G +L+ASGGTA A+RNAG+ V+DVS+IT APEMLGG Sbjct: 33 GSLALLSVSNKKGLVEFAKQLHDLGFRLVASGGTANAIRNAGIPVRDVSEITGAPEMLGG 92 Query: 188 RVKTLHPAVHAGILARLSDSDQ 253 RVKTLHPAVH GILAR+S+ D+ Sbjct: 93 RVKTLHPAVHGGILARVSEGDK 114 Score = 86.6 bits (205), Expect = 2e-17 Identities = 40/78 (51%), Positives = 52/78 (66%) Frame = +3 Query: 405 KNHDRVTVVCDPADYDAVVKEIKENKHHQTTLGTSRD*P*RRSLILSDYDLAISDYFRKQ 584 KNH+RVTVVCDP DY+ V+ E+ EN+ T T + + + YD+AISDYFRK+ Sbjct: 166 KNHERVTVVCDPEDYNKVLSEMTENETCDTLPDTRKTLALKAFSHTASYDMAISDYFRKE 225 Query: 585 YSPGQAQLTLRYGMNPHQ 638 YS + + LRYGMNPHQ Sbjct: 226 YSENVSHIPLRYGMNPHQ 243 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 256 DMKRQKYEMXSVVVCNLYPFVQTVSKPDVTVADAVENIDIGGVTLLRA 399 DM +Q +E VVVCNLYPFV TV+K V V++AVE IDIGGVTLLRA Sbjct: 116 DMAKQGFEYIRVVVCNLYPFVNTVAKEGVIVSEAVEQIDIGGVTLLRA 163 >SB_57127| Best HMM Match : MGS (HMM E-Value=0.25) Length = 79 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 256 DMKRQKYEMXSVVVCNLYPFVQTVSKPDVTVADAVENIDIGGVTLLRA 399 DM +Q +E VVVCNLYPFV TV+K V V++AVE IDIGGVTLLRA Sbjct: 13 DMAKQGFEYIRVVVCNLYPFVNTVAKEGVIVSEAVEQIDIGGVTLLRA 60 Score = 35.5 bits (78), Expect = 0.037 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 405 KNHDRVTVVCDPADYD 452 KNH+RVTVVCDP DY+ Sbjct: 63 KNHERVTVVCDPEDYN 78 >SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 645 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 1 GKWKTSSSQRFRQDGSTLVSKEP 69 G+W T ++R+R+DGS ++ EP Sbjct: 333 GQWHTVVAERYRRDGSLILDSEP 355 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 414 DRVTVVCDPADYDAVVKEIKE-NKHHQTTL 500 D + CDPA+ +A++ I+E N+HHQ L Sbjct: 1447 DGILRTCDPAELEALLMLIEEQNEHHQKVL 1476 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/75 (21%), Positives = 29/75 (38%) Frame = +1 Query: 343 TVADAVENIDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISP 522 T+ +D+ G+ L + + T +KK + IIR +W E P Sbjct: 240 TLCKQTNQVDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEP 299 Query: 523 EGVHSYFRTMTSPYR 567 E + + +P+R Sbjct: 300 EKHYRELLMLFTPWR 314 >SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 158 CPTHLEL*GRRSEAPWRYRHWQSTAGHIPTGSLLTRVDPSCLK 30 CP + + R+ + Y W+ TG+L+TR++PS +K Sbjct: 447 CPNDITITTARNNSKAAYVTWKPPQAVDNTGNLVTRIEPSEIK 489 >SB_26612| Best HMM Match : NC (HMM E-Value=6.7) Length = 451 Score = 28.7 bits (61), Expect = 4.2 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = -2 Query: 488 MMFVLFDFFDYSIVVGRVTDDGDPVVVLGSARRRVTPPMSMFSTASAT---VTSGLDTVW 318 + V+ + S+ R+T D V R+TP M TAS T +T +DTV+ Sbjct: 133 LTLVMDTVYTASVTFYRLTPVMDTVYTASVTFYRLTPVMDTVYTASVTFYRLTPVMDTVY 192 Query: 317 TNGYRLQTTTLII 279 T TL++ Sbjct: 193 TASVTFYRLTLVM 205 Score = 28.3 bits (60), Expect = 5.6 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = -2 Query: 479 VLFDFFDYSIVVGRVTDDGDPVVVLGSARRRVTPPMSMFSTASAT---VTSGLDTVWTNG 309 V+ + S+ RVT D V R+TP M TAS T +T +DTV+T Sbjct: 68 VMDTVYTASVTFYRVTLVMDTVYTASVTFYRLTPVMDTVYTASVTFYRLTPVMDTVYTAS 127 Query: 308 YRLQTTTLII 279 TL++ Sbjct: 128 VTFYRLTLVM 137 Score = 28.3 bits (60), Expect = 5.6 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 3/74 (4%) Frame = -2 Query: 488 MMFVLFDFFDYSIVVGRVTDDGDPVVVLGSARRRVTPPMSMFSTASAT---VTSGLDTVW 318 + V+ + S+ R+T D V R+TP M TAS T VT +DTV+ Sbjct: 269 LTLVMDTVYTASVTFYRLTLVMDTVYTASVTFYRLTPVMDTVYTASVTFFRVTLVMDTVY 328 Query: 317 TNGYRLQTTTLIIS 276 T TL+++ Sbjct: 329 TASVTFFRVTLVMN 342 >SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 473 FDFFDYSIVVGRVTDDGDPVVVL 405 FDF D+SI+V ++T PVV++ Sbjct: 294 FDFIDHSILVDKLTYQARPVVIV 316 >SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 364 NIDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRL 498 N D+ + P PSS TR T +KK R+N+++++ Sbjct: 377 NWDLNPTDHTQFVPSKAAAKPSSPTRTTQQYHTKKGHRSNVVQKV 421 >SB_50503| Best HMM Match : DUF1661 (HMM E-Value=5.8) Length = 533 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 459 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 518 Query: 547 TMTSPYR 567 + +P+R Sbjct: 519 MLFTPWR 525 >SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 517 SPEGVHSYFRTMTSPYRTTSASNTR 591 SP G Y +SPY TT + TR Sbjct: 293 SPPGAGGYHSAFSSPYATTQVTGTR 317 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +1 Query: 295 VCNLYPFVQTVSKPDVTVADAVENIDIGGVTLLRAEPRTTTGSPSSVTRPTTM 453 +C+ +V P V + I VT PRTT P+S + P TM Sbjct: 1446 ICSFVKYVAQFGAPPVQPLSGPQRASISRVT-----PRTTPDKPTSSSTPVTM 1493 >SB_25530| Best HMM Match : DUF1661 (HMM E-Value=5.8) Length = 160 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 49 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 108 Query: 547 TMTSPYR 567 + +P+R Sbjct: 109 MLFTPWR 115 >SB_18494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 1089 VDVDGLPLENFVDDNLNDDDDTKAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 1148 Query: 547 TMTSPYR 567 + +P+R Sbjct: 1149 MLFTPWR 1155 >SB_17642| Best HMM Match : DUF1128 (HMM E-Value=0.92) Length = 1100 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 749 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 808 Query: 547 TMTSPYR 567 + +P+R Sbjct: 809 MLFTPWR 815 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 319 QTVSKPDVTVADAVENIDIGGVTLLRAEPRTTTGSPSSVTRPTT 450 +T P+ T +I GV+ A P TT+G P + T P T Sbjct: 2571 ETTFVPETTAVPETTGSEITGVSETTAVPETTSG-PMTTTGPET 2613 >SB_47644| Best HMM Match : Ldh_1_C (HMM E-Value=4.8) Length = 243 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 56 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 115 Query: 547 TMTSPYR 567 + +P+R Sbjct: 116 MLFTPWR 122 >SB_42065| Best HMM Match : DUF1661 (HMM E-Value=5.8) Length = 234 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 56 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 115 Query: 547 TMTSPYR 567 + +P+R Sbjct: 116 MLFTPWR 122 >SB_14380| Best HMM Match : DUF1661 (HMM E-Value=5.8) Length = 384 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +1 Query: 367 IDIGGVTLLRAEPRTTTGSPSSVTRPTTML*SKKSKRTNIIRRLWAQAEISPEGVHSYFR 546 +D+ G+ L + + T +KK + IIR +W E PE + Sbjct: 248 VDVDGLPLENFVDDNLNDDDDTEAQKTPRSKTKKRAKARIIRSVWFNKEAEPEKHYRELL 307 Query: 547 TMTSPYR 567 + +P+R Sbjct: 308 MLFTPWR 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,207,347 Number of Sequences: 59808 Number of extensions: 387446 Number of successful extensions: 1131 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -