BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0925 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 26 0.27 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 24 1.4 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 1.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.8 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 7.6 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 26.2 bits (55), Expect = 0.27 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 481 NIIRRLWAQAEISPEGVHSYFRTMTSP 561 +++ R+W G HSY T+TSP Sbjct: 80 SMLARIWKPDTYFYNGKHSYLHTITSP 106 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 47 LLSLAKSLSECGLQLIASGGTATALRNA 130 LLS +S+SEC L +S + + RN+ Sbjct: 166 LLSKRRSVSECSLGTASSTSSTASSRNS 193 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 484 IIRRLWAQAEISPEGVHSYFRTMTSP 561 ++ R+W G HSY T+T P Sbjct: 113 MLERIWRPDTYFYNGKHSYVHTITVP 138 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 167 APEMLGGRVKTLHPAV 214 AP MLGGR T + V Sbjct: 340 APHMLGGRTDTTYRVV 355 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -1 Query: 264 FHVSWSESDNRAKIPACTAGCKVFTRPPSIS 172 + V+W+ A++ CT G +P IS Sbjct: 518 YSVNWTIGQLEAEVINCTTGKDELGKPSRIS 548 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,932 Number of Sequences: 438 Number of extensions: 2875 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -