BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0924 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 44 8e-05 SB_40817| Best HMM Match : Peptidase_M16_C (HMM E-Value=1.6e-36) 35 0.046 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.25 SB_42042| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_25632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 28 7.0 SB_35949| Best HMM Match : Cadherin (HMM E-Value=0) 27 9.2 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 27 9.2 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = +3 Query: 252 PVTRVTIAFKAGSRYEPQAELGLSHVLRSAAGLTTKNISSFLIQRKLSQIG 404 P++RV + F AGSRYE + LG++H+LR+AA L + ++++ +G Sbjct: 49 PISRVGLFFDAGSRYETDSNLGITHMLRNAAYLLLDFKGKHFVGKRMALVG 99 >SB_40817| Best HMM Match : Peptidase_M16_C (HMM E-Value=1.6e-36) Length = 888 Score = 35.1 bits (77), Expect = 0.046 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +3 Query: 264 VTIAFKAGSRYEPQAELGLSHVLRSAAGLTTKNISSF-LIQRKLSQIGAYVSASGDREFI 440 V + GSRYE G++HV+ A +T S I ++L +G + R+ I Sbjct: 440 VGVVIDGGSRYEVDHPNGVTHVIEKMAFQSTAKFPSHDDIMQELEPVGGMADCTSFRDAI 499 Query: 441 YYTLEATQDKLNDALEILNNLV 506 Y + L A+E+L+ V Sbjct: 500 VYGTSSFTSGLPLAVEVLSEAV 521 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 32.7 bits (71), Expect = 0.25 Identities = 36/133 (27%), Positives = 56/133 (42%) Frame = +3 Query: 36 REDSVNHKPLLRYYLKFLKTYENGIQNSRRPLYSSCYDQGLRPSCAGSKERC*DPIKCFT 215 R D VN + L L+ + E GI RR LYS C+D+ +R ER + Sbjct: 135 RLDVVNLQEQLDMRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAER--GLLLLRV 192 Query: 216 *QDVRSCFRQRFPVTRVTIAFKAGSRYEPQAELGLSHVLRSAAGLTTKNISSFLIQRKLS 395 ++R + ++AF G R QAE G S + R L ++R+++ Sbjct: 193 RDEIRMTIAAYQTLYESSVAF--GMRKALQAEQGKSDMERKITELENDKRE---LERQVN 247 Query: 396 QIGAYVSASGDRE 434 ++ A A RE Sbjct: 248 ELKAKCDAIEKRE 260 >SB_42042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 31.5 bits (68), Expect = 0.57 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -1 Query: 561 YFRRGALSLSSHGL---NSWLKLSYSGSPVHHSICPVLLP 451 YFR A+ SS L N WLKLS P H + P ++P Sbjct: 268 YFRNTAIFRSSCKLPVTNFWLKLSTIKEPCHRPVTPTVIP 307 >SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 123 DESFGCHFRKFLETLGSIATKAYDLRSLLFLRKSLGLV 10 DE F RKF+E + S + D+ L+ + KSLG V Sbjct: 26 DERFLFQSRKFMEMINSAVDRLNDISLLVMILKSLGEV 63 >SB_25632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -3 Query: 343 AADRSTCDNPNSACGS*REPALKAIVTRVT--GNRCL 239 AADR T D+PN++ S R+ AL+++ T GN CL Sbjct: 167 AADRETIDDPNTS-ESRRQEALQSLSCECTSMGNDCL 202 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 33 GREDSVNHKPLLRYYLKFLKTYENGIQNSRRPLYSSCYDQGL 158 G+E VN K LLR+ + E G Q L CY L Sbjct: 239 GKEHIVNLKQLLRWAVNRQMKAEGGFQGRTNKLVDGCYSYWL 280 >SB_35949| Best HMM Match : Cadherin (HMM E-Value=0) Length = 521 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 229 VAALDNGSPLPVSQSPSKLALVMNHKPNWDCRMYYDQLLD*QP 357 V A D+GSP S + L +NH P + Y +L QP Sbjct: 272 VLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQP 314 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 229 VAALDNGSPLPVSQSPSKLALVMNHKPNWDCRMYYDQLLD*QP 357 V A D+GSP S + L +NH P + Y +L QP Sbjct: 808 VLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQP 850 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,516,905 Number of Sequences: 59808 Number of extensions: 380777 Number of successful extensions: 979 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 978 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -