BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0922 (590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 22 3.4 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 7.8 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 21 7.8 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 21 7.8 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 460 KKAIEKCRLERRGLSA*LEMF*I*GKFIMLYYCTVK 567 +K +++ RLE + ++ I G F+M +C +K Sbjct: 53 RKNVQEIRLEWKSFRFVYAVYNIFGAFVMGLFCILK 88 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +2 Query: 290 VQTFSQFFIVQKEYLLCW 343 V+T F++ ++LCW Sbjct: 247 VKTIKITFVIVSVFILCW 264 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 21.0 bits (42), Expect = 7.8 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 363 LVKVAQALPT-CAVQLVFNDYFF 428 L K+ L C+V LVF YFF Sbjct: 66 LAKITTILQRYCSVLLVFLTYFF 88 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 21.0 bits (42), Expect = 7.8 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 363 LVKVAQALPT-CAVQLVFNDYFF 428 L K+ L C+V LVF YFF Sbjct: 62 LAKITTILQRYCSVLLVFLTYFF 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,685 Number of Sequences: 336 Number of extensions: 1827 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -