BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0921 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.9 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 404 VWTQGDDGKWATTLVLLRINRAATCVKWSPME 499 +W +DGK L+ + V++SPME Sbjct: 9 LWCPDNDGKMVDLTQCLQESSTGQSVEFSPME 40 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 628 WEPINRCHSRTNGLLNMLRHPPI 560 W+P+++C+ +G L PP+ Sbjct: 421 WKPLDKCYFCLDGKLPHDDQPPL 443 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 625 EPINRCHSRTNGLLNMLRHP 566 EPI + + RT G L HP Sbjct: 334 EPITQSNKRTAGNLATREHP 353 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 237 QIAXSPTIMKFTYTK 281 Q+ PTI +F++TK Sbjct: 578 QVMVPPTIQQFSFTK 592 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 282 RKEMTGSKQTTLWNTTL 332 +KE G QTTL TTL Sbjct: 294 KKERNGPTQTTLNATTL 310 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 282 RKEMTGSKQTTLWNTTL 332 +KE G QTTL TTL Sbjct: 384 KKERNGPTQTTLNATTL 400 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,119 Number of Sequences: 438 Number of extensions: 4356 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -