BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0921 (633 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 140 7e-34 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 140 7e-34 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 140 7e-34 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 41 6e-04 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 41 8e-04 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 40 0.001 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 37 0.010 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 36 0.030 At5g64630.3 68418.m08123 transducin family protein / WD-40 repea... 33 0.12 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 33 0.12 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 33 0.12 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 33 0.12 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 33 0.12 At2g20800.1 68415.m02446 pyridine nucleotide-disulphide oxidored... 33 0.12 At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta... 33 0.16 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 33 0.16 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 33 0.21 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 32 0.28 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 32 0.28 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 0.64 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 31 0.64 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 31 0.64 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 31 0.64 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 31 0.84 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 31 0.84 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 31 0.84 At1g04510.1 68414.m00442 transducin family protein / WD-40 repea... 30 1.5 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 29 1.9 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 29 1.9 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 29 1.9 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 29 1.9 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 29 1.9 At2g16405.1 68415.m01878 transducin family protein / WD-40 repea... 29 1.9 At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ... 29 2.6 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 29 2.6 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 29 2.6 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 29 3.4 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 29 3.4 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 29 3.4 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 28 4.5 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 28 4.5 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 27 7.8 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 27 7.8 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 27 7.8 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 27 7.8 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 27 7.8 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 27 7.8 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 140 bits (339), Expect = 7e-34 Identities = 67/127 (52%), Positives = 87/127 (68%), Gaps = 2/127 (1%) Frame = +2 Query: 254 NNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGK 430 NN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ + + Sbjct: 30 NNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL-EGAE 88 Query: 431 WATTLVLLRINRAATCVKWSPMENKF-LSVRS*IDIICYFEXGNNWWVSKHIKKPIRSTV 607 W TLV+LR+NRAA CV+WSP ENKF + + ICY+E NNWWVSK I+K S+V Sbjct: 89 WVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSV 148 Query: 608 TSIDWLP 628 TS+ W P Sbjct: 149 TSVAWHP 155 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 204 ITCHAWNKDRSQIAXSP 254 ITCHAW+ D S +A P Sbjct: 13 ITCHAWSPDLSMVALCP 29 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 275 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 412 Y++E N W H+ V + W PN + T S D V++ Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFS 173 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 140 bits (339), Expect = 7e-34 Identities = 67/127 (52%), Positives = 87/127 (68%), Gaps = 2/127 (1%) Frame = +2 Query: 254 NNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGK 430 NN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ + + Sbjct: 30 NNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL-EGAE 88 Query: 431 WATTLVLLRINRAATCVKWSPMENKF-LSVRS*IDIICYFEXGNNWWVSKHIKKPIRSTV 607 W TLV+LR+NRAA CV+WSP ENKF + + ICY+E NNWWVSK I+K S+V Sbjct: 89 WVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSV 148 Query: 608 TSIDWLP 628 TS+ W P Sbjct: 149 TSVAWHP 155 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +2 Query: 275 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT---QGDDGKWA 436 Y++E N W H+ V + W PN + T S D V++ +G D K+A Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFSTFIKGVDTKYA 184 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 204 ITCHAWNKDRSQIAXSP 254 ITCHAW+ D S +A P Sbjct: 13 ITCHAWSPDLSMVALCP 29 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 140 bits (339), Expect = 7e-34 Identities = 67/127 (52%), Positives = 87/127 (68%), Gaps = 2/127 (1%) Frame = +2 Query: 254 NNNEVHIYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGK 430 NN EVHIYK D W++ + L +HD V GIDW+ +N+IVT S DRN+YVW+ + + Sbjct: 30 NNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSL-EGAE 88 Query: 431 WATTLVLLRINRAATCVKWSPMENKF-LSVRS*IDIICYFEXGNNWWVSKHIKKPIRSTV 607 W TLV+LR+NRAA CV+WSP ENKF + + ICY+E NNWWVSK I+K S+V Sbjct: 89 WVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSV 148 Query: 608 TSIDWLP 628 TS+ W P Sbjct: 149 TSVAWHP 155 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 204 ITCHAWNKDRSQIAXSP 254 ITCHAW+ D S +A P Sbjct: 13 ITCHAWSPDLSMVALCP 29 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 275 YKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT 412 Y++E N W H+ V + W PN + T S D V++ Sbjct: 128 YEQENNWWVSKLIRKRHESSVTSVAWHPNNVLLATTSTDGKCRVFS 173 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 41.1 bits (92), Expect = 6e-04 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +2 Query: 281 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTCSV-DRNAYVWTQGDDGKWATTLV 448 KEGN W Q + +H + V I WAP+ + + C D N V++ DG W TT + Sbjct: 86 KEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKI 145 Query: 449 LLRINRAATCVKWSP 493 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 33.9 bits (74), Expect = 0.090 Identities = 25/109 (22%), Positives = 42/109 (38%), Gaps = 4/109 (3%) Frame = +2 Query: 314 LVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 487 L H V + WA P ++ +CS D +W +G+ +W V + + W Sbjct: 52 LTGHRGPVWQVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAW 111 Query: 488 SPME--NKFLSVRS*IDIICYFEXGNNWWVSKHIKKPIRSTVTSIDWLP 628 +P E S +I + + W + I + VTS+ W P Sbjct: 112 APHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAP 160 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +2 Query: 281 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 451 KEG W+ T L + V + W+ N + + N VW + DG+W V+ Sbjct: 245 KEGEQWEGTV-LKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVV 300 Score = 31.5 bits (68), Expect = 0.48 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +2 Query: 257 NNEVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 418 ++ V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIG 244 Query: 419 DDGKWATTLVLLRINRAATCVKWS 490 +G+ VL V WS Sbjct: 245 KEGEQWEGTVLKDFKTPVWRVSWS 268 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/74 (22%), Positives = 37/74 (50%) Frame = +2 Query: 272 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 451 I+K G++++ + L H+ V + W + + + TCS D++ ++W + ++ VL Sbjct: 100 IWKNYGSEFECISTLEGHENEVKSVSWNASGSCLATCSRDKSVWIWEVLEGNEYDCAAVL 159 Query: 452 LRINRAATCVKWSP 493 + V+W P Sbjct: 160 TGHTQDVKMVQWHP 173 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +2 Query: 284 EGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYV-WTQGDDGKWATTLVLLRI 460 EGN++ L H V + W P + + +CS D V W++ DDG++ L Sbjct: 149 EGNEYDCAAVLTGHTQDVKMVQWHPTMDVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGES 208 Query: 461 NRAATCVKWS 490 N + WS Sbjct: 209 NNGHSSTVWS 218 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +2 Query: 281 KEGND--WKQTNNLVEHDLRVMGIDWAPNTNRI-VTC-SVDRNAYVWTQGDDGKWATTLV 448 KEGN W Q + +H V I WAP+ + + C S D N V+T DG W T+ + Sbjct: 86 KEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSLACGSSDGNISVFTARADGGWDTSRI 145 Query: 449 LLRINRAATCVKWSP 493 T V W+P Sbjct: 146 DQAHPVGVTSVSWAP 160 Score = 36.3 bits (80), Expect = 0.017 Identities = 26/114 (22%), Positives = 44/114 (38%), Gaps = 4/114 (3%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWA-PNTNRIV-TCSVDRNAYVWTQGDDGKWATTLVLLRINRAA 472 +Q L H V + WA P I+ +CS D +W +G+ +W V + Sbjct: 47 QQLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSV 106 Query: 473 TCVKWSPME--NKFLSVRS*IDIICYFEXGNNWWVSKHIKKPIRSTVTSIDWLP 628 + W+P + S +I + + W + I + VTS+ W P Sbjct: 107 NSIAWAPHDIGLSLACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAP 160 Score = 33.1 bits (72), Expect = 0.16 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +2 Query: 257 NNEVHIYKKEGNDWKQT--NNLVEHDLRVMGIDWAPNT----NRIVTCSVDRNAYVWTQG 418 +N V ++K WK L +H V + WAPN + I + S D +WT G Sbjct: 185 DNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVIIWTVG 244 Query: 419 DDGKWATTLVLLRINRAATCVKWS 490 +G+ VL V WS Sbjct: 245 KEGEQWEGKVLKDFMTPVWRVSWS 268 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 281 KEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKW 433 KEG W + L + V + W+ N + + N VW + DG+W Sbjct: 245 KEGEQW-EGKVLKDFMTPVWRVSWSLTGNLLAVSDGNNNVTVWKEAVDGEW 294 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 37.1 bits (82), Expect = 0.010 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG 427 H + + W+P++ R++T S D++A VW +DG Sbjct: 95 HKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDG 129 Score = 33.9 bits (74), Expect = 0.090 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 257 NNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 N E ++ +E K NN++ H R+ + W+PN + T S+D V+ Sbjct: 377 NREAVVWDRETKQVK-LNNMLFHTARINSLAWSPNNKMVATGSIDTCVIVY 426 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 35.5 bits (78), Expect = 0.030 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 326 DLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 DL+V +DW P NRIV+ S D VW Sbjct: 3 DLQVYSLDWTPERNRIVSASQDGRLIVW 30 >At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 428 Score = 33.5 bits (73), Expect = 0.12 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 1/107 (0%) Frame = +2 Query: 272 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 448 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 34 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 90 Query: 449 LLRINRAATCVKWSPMENKFLSVRS*IDIICYFEXGNNWWVSKHIKK 589 L V W P+ S+ S D C SK ++K Sbjct: 91 LDAHCHYVQGVAWDPLAKYVASLSS--DRTCRIYANKPQTKSKGVEK 135 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 33.5 bits (73), Expect = 0.12 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 1/107 (0%) Frame = +2 Query: 272 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 448 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 149 Query: 449 LLRINRAATCVKWSPMENKFLSVRS*IDIICYFEXGNNWWVSKHIKK 589 L V W P+ S+ S D C SK ++K Sbjct: 150 LDAHCHYVQGVAWDPLAKYVASLSS--DRTCRIYANKPQTKSKGVEK 194 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 33.5 bits (73), Expect = 0.12 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 1/107 (0%) Frame = +2 Query: 272 IYKKEGND-WKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLV 448 ++ E N WK +L H V+ + W+P+ +++ SVD + +W D K + + Sbjct: 93 LHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIW---DVNKGSVHQI 149 Query: 449 LLRINRAATCVKWSPMENKFLSVRS*IDIICYFEXGNNWWVSKHIKK 589 L V W P+ S+ S D C SK ++K Sbjct: 150 LDAHCHYVQGVAWDPLAKYVASLSS--DRTCRIYANKPQTKSKGVEK 194 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/76 (21%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +2 Query: 272 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW--TQGDDGKWATTL 445 +++ D + + L H+ V + W + + + TC D++ ++W +D ++ T Sbjct: 74 VWENFATDSESVSVLRGHESEVKSVSWNASGSLLATCGRDKSVWIWEIQPEEDDEFDTIA 133 Query: 446 VLLRINRAATCVKWSP 493 VL + V W P Sbjct: 134 VLTGHSEDVKMVLWHP 149 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +2 Query: 272 IYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW-TQGDDGKWATTLV 448 I +E +++ L H V + W P + + +CS D +W ++ +DG + Sbjct: 121 IQPEEDDEFDTIAVLTGHSEDVKMVLWHPTMDVLFSCSYDNTIKIWCSEDEDGDYNCVQT 180 Query: 449 LLRINRAATCVKWS 490 L +N + WS Sbjct: 181 LSELNNGHSSTVWS 194 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWAPNTNRIV-TCSVDRNAYVWTQ 415 ++ L H RV + W P + ++ +CS D+ +W Q Sbjct: 11 EEVQKLEGHTDRVWNVAWNPAADGVIASCSADKTVRIWEQ 50 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 33.5 bits (73), Expect = 0.12 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVL 451 H + + W+P+ +++T S D++A +W D+G + L Sbjct: 231 HKGSIYAVSWSPDGKQVLTVSADKSAKIWDISDNGSGSLNTTL 273 >At2g20800.1 68415.m02446 pyridine nucleotide-disulphide oxidoreductase family protein similar to GI:3718005 alternative NADH-dehydrogenase {Yarrowia lipolytica} ; contains Pfam profile PF00070: Pyridine nucleotide-disulphide oxidoreductase Length = 582 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +2 Query: 245 IXTNNNEVHIYKKEGNDWKQTNNL-VEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGD 421 I +N ++H KEG+ K T +++D+ ++ + PNT T V+ +AY + + Sbjct: 140 IDASNKKIHCRSKEGSSLKGTTEFDMDYDILILAVGAKPNT--FNTPGVEEHAYFLKEAE 197 Query: 422 D 424 D Sbjct: 198 D 198 >At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 347 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 H +V +DW P NRIV+ S D VW Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVW 92 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 H +V +DW P NRIV+ S D VW Sbjct: 64 HTGKVYSLDWTPERNRIVSASQDGRLIVW 92 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 32.7 bits (71), Expect = 0.21 Identities = 19/67 (28%), Positives = 28/67 (41%) Frame = +2 Query: 314 LVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSP 493 LV H V + ++ + + T S D A +W DD K L + V WSP Sbjct: 220 LVAHKNEVWFVQFSNSGKYLATASSDCTAIIWKVLDDNKVELKHTLESHQNPVSFVSWSP 279 Query: 494 MENKFLS 514 + K L+ Sbjct: 280 DDTKLLT 286 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 32.3 bits (70), Expect = 0.28 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +2 Query: 293 DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 +WK L H V+ ++W+P+ + + + S+D ++W Sbjct: 107 NWKAVMTLRGHTADVVDLNWSPDDSMLASGSLDNTVHIW 145 Score = 28.3 bits (60), Expect = 4.5 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +2 Query: 257 NNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGD----- 421 +N VHI+ T L H V G+ W P + I + S D+ +W D Sbjct: 139 DNTVHIWNMRTG--MCTTVLRGHLSLVKGVTWDPIGSFIASQSDDKTVIIWRTSDWGMAH 196 Query: 422 --DGKWATTL 445 DG WA +L Sbjct: 197 RTDGHWAKSL 206 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPME 499 H + W P ++ T S D+ +W+ +D + LVL + T V W+ ++ Sbjct: 695 HKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLPPFGSSVTAVAWTGLD 753 Score = 31.1 bits (67), Expect = 0.64 Identities = 28/134 (20%), Positives = 62/134 (46%), Gaps = 5/134 (3%) Frame = +2 Query: 236 SNCIXTNNNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT- 412 S+C + + I+ E WK L H L V ++++ + +++ S DR+ V++ Sbjct: 617 SSCKAQSASMAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSI 676 Query: 413 -QGDDGKWATTLV--LLRINRAATCVKWSPMENKFLSVRS*IDIICYFEXGNNWWVSK-H 580 + D+G+ + L+ + R W+P ++F + S + + N+ + + Sbjct: 677 QRTDNGEVSHKLMAKVEAHKRIIWACSWNPFGHQF-ATSSRDKTVKIWSVENDARIKQIL 735 Query: 581 IKKPIRSTVTSIDW 622 + P S+VT++ W Sbjct: 736 VLPPFGSSVTAVAW 749 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 31.1 bits (67), Expect = 0.64 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 287 GNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWT-QGDD 424 G D+ +L H+ +V +D +++ I T S DR +WT G+D Sbjct: 495 GRDFSLVKSLAGHESKVASLDITADSSCIATVSHDRTIKLWTSSGND 541 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 31.1 bits (67), Expect = 0.64 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 478 K +L H ++ + W+ + +++ S+D+ +W D + T L L N TC Sbjct: 497 KPVCSLKGHLDAILDLSWS-KSQLLLSSSMDKTVRLW----DIETKTCLKLFAHNDYVTC 551 Query: 479 VKWSPM-ENKFLS 514 +++SP+ EN FLS Sbjct: 552 IQFSPVDENYFLS 564 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 31.1 bits (67), Expect = 0.64 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = +2 Query: 308 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 487 + L H +V + + +++ ++T S D+ +W DG +A L + V Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYACGYTLNDHSAEVRAVTV 317 Query: 488 SPMENKFLS 514 P F+S Sbjct: 318 HPTNKYFVS 326 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 31.1 bits (67), Expect = 0.64 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = +2 Query: 308 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 487 + L H +V + + +++ ++T S D+ +W DG +A L + V Sbjct: 258 STLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYACGYTLNDHSAEVRAVTV 317 Query: 488 SPMENKFLS 514 P F+S Sbjct: 318 HPTNKYFVS 326 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 30.7 bits (66), Expect = 0.84 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 478 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 479 VKWSPMEN 502 V+++P+++ Sbjct: 402 VQFNPVDD 409 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 30.7 bits (66), Expect = 0.84 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 478 K + + H ++ I W+ N NR+++ SVD + +W G + L + N T Sbjct: 347 KPLHEFLGHSGDILDISWSKN-NRLLSASVDNSVRLWQIGCE----DCLGIFSHNNYVTS 401 Query: 479 VKWSPMEN 502 V+++P+++ Sbjct: 402 VQFNPVDD 409 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 30.7 bits (66), Expect = 0.84 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +2 Query: 302 QTNNLVE-HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATC 478 QT ++E H V + ++ N + + S D+ A +W DG + L+ ++ Sbjct: 265 QTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIA 324 Query: 479 VKWSPMENKFLS 514 + WSP + + L+ Sbjct: 325 ILWSPDDRQVLT 336 >At1g04510.1 68414.m00442 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 523 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +2 Query: 308 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWAT 439 + L H +V I + +T+ ++T S D+ +W +DG + + Sbjct: 258 STLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIWGCSEDGNYTS 301 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 320 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 445 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 548 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 589 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 320 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 445 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 320 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 445 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 320 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 445 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 320 EHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTL 445 EH + + + PN+ ++ T S D+ +W D G + T+ Sbjct: 550 EHAHIITDVRFRPNSTQLATSSFDKTIKIWDASDPGYFLRTI 591 >At2g16405.1 68415.m01878 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD-repeat protein 13 (SP:Q9H1Z4) [Homo sapiens] Length = 482 Score = 29.5 bits (63), Expect = 1.9 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 1/103 (0%) Frame = +2 Query: 314 LVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSP 493 L H V D++ N I + S+D+ VW + + V+ I+ C+++ P Sbjct: 212 LTGHSKDVTDFDFSSNNQYIASSSLDKTIRVW---ELSRGVCIRVIYGIS-PQYCIRFHP 267 Query: 494 MENKFLSVRS*IDIICYFEXGNNWWVSKHIKKPI-RSTVTSID 619 + N FLS + + F N+ + IKK + VTS+D Sbjct: 268 VNNNFLSAGNANKELTVF----NFSTGRIIKKLLFEDEVTSMD 306 >At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Fzr1 (GI:6463679){Homo sapiens} Length = 481 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = +2 Query: 308 NNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKW 487 + LV H V G+ W+ + + + D VW ++ L L A + W Sbjct: 292 SKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVW---NNHSQQPILKLTEHTAAVKAITW 348 Query: 488 SPMENKFLS 514 SP ++ L+ Sbjct: 349 SPHQSSLLA 357 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +2 Query: 299 KQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDG 427 K L EH + I ++P+ R+ T S D+ VW + G Sbjct: 684 KPKTTLEEHTAMITDIRFSPSQLRLATSSFDKTVRVWDADNKG 726 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 272 IYKKEGN--DWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 +Y+K+G+ + + L H V + ++PN+ +I+T S D + VW Sbjct: 269 VYQKDGSVKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVW 316 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 493 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 265 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 324 Query: 494 MENKFLS 514 + L+ Sbjct: 325 FQANLLA 331 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVK---WSP 493 H V G+ W+ + ++ + D ++W + +TT L R+ + VK W P Sbjct: 255 HTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCP 314 Query: 494 MENKFLS 514 + L+ Sbjct: 315 FQANLLA 321 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +2 Query: 323 HDLRVMGIDWAPNTNR-IVTCSVDRNAYVWTQGD---DGKWATTLVLLRINRAATCVKWS 490 HD + +DW P+ N I+T S D V+ + + +G + A CV+WS Sbjct: 325 HDADLHCVDWNPHDNNLILTGSADNTVRVFDRRNLTSNGVGSPVYKFEGHRAAVLCVQWS 384 Query: 491 P 493 P Sbjct: 385 P 385 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +2 Query: 251 TNNNEVHIYKKEGNDWKQTNNLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVWTQGDDGK 430 T++ + IY + + + H V + W P + + +CS D A +W + K Sbjct: 423 TSSTDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIW----NIK 478 Query: 431 WATTLVLLRIN-RAATCVKWSP 493 +T + LR + + ++WSP Sbjct: 479 QSTFVHDLREHTKEIYTIRWSP 500 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 344 IDWAPNTNRIVTCSVDRNAYVW 409 +DW PN N I T S D+ +W Sbjct: 505 VDWHPNCNYIATGSSDKTVRLW 526 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 323 HDLRVMGIDWAPN-TNRIVTCSVDRNAYVW 409 HD V +DW+P+ ++ T S D +W Sbjct: 380 HDFEVTAVDWSPSEIGKVATASDDFTVRLW 409 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 311 NLVEHDLRVMGIDWAPNTNRIVTCSVDRNAYVW 409 +L H L VM ID + + IVT S D+N +W Sbjct: 577 SLYGHKLPVMCIDISSDGELIVTGSQDKNLKIW 609 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 290 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 418 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 290 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 418 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 290 NDWKQTNNLVEHDLRVMGIDWAP-NTNRIVTCSVDRNAYVWTQG 418 N W T H VM + + P +TN + S+DR +W G Sbjct: 130 NGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWNLG 173 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 27.5 bits (58), Expect = 7.8 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 1/81 (1%) Frame = +2 Query: 320 EHDLRVMGIDWA-PNTNRIVTCSVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPM 496 EH+ R +D++ + +V+ S D VW + +++ + + CVK++P Sbjct: 461 EHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEA----SVINIDMKANICCVKYNPG 516 Query: 497 ENKFLSVRS*IDIICYFEXGN 559 + +++V S I Y++ N Sbjct: 517 SSNYIAVGSADHHIHYYDLRN 537 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,921,601 Number of Sequences: 28952 Number of extensions: 291883 Number of successful extensions: 871 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -