BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0920 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.47 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.7 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 5.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.6 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 7.6 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.47 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 69 VSAGVTEMSAGSMSSSNKELEEKLYNSILTGDYDSA 176 V AG+ E SAG+ +S K+ + G YD + Sbjct: 1242 VGAGIAETSAGTSNSRGAAQMSKVPRDVSEGIYDGS 1277 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 219 WSPCLGSRIPSSDGQRCRSHR 157 + P LG + S GQ+ R+HR Sbjct: 118 FKPWLGDGLLISTGQKWRNHR 138 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 591 PCYIRHQHRRHHQ 629 P Y H H HHQ Sbjct: 68 PIYQSHHHLHHHQ 80 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 307 LSVADPQLVAVLHGVPTSSMIRLLTTFWMMEPLPW 203 LS DP +V +P + R L F+ E LP+ Sbjct: 320 LSHVDPDVVQYFGYLPQDMVGRSLFDFYHPEDLPF 354 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 307 LSVADPQLVAVLHGVPTSSMIRLLTTFWMMEPLPW 203 LS DP +V +P + R L F+ E LP+ Sbjct: 26 LSHVDPDVVQYFGYLPQDMVGRSLFDFYHPEDLPF 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,052 Number of Sequences: 438 Number of extensions: 3449 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -