BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0917 (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 5.9 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.8 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 271 WXTPTSSGCXAPRXSSGIVS 330 W TPTSS G++S Sbjct: 7 WDTPTSSAPAFSEQRGGVIS 26 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 20.6 bits (41), Expect = 7.8 Identities = 6/30 (20%), Positives = 18/30 (60%) Frame = +3 Query: 276 YAYQLWMQXSEXIVRDCFPVEFTLILAENY 365 ++ Q+ + +E FP+++TL+ + ++ Sbjct: 343 FSLQILNERAEFNAAGFFPIDYTLVFSVSF 372 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,128 Number of Sequences: 336 Number of extensions: 1479 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -