BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0917 (480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0019 - 129767-129931,130078-130257,130491-130728,130833-13... 29 1.5 >05_01_0019 - 129767-129931,130078-130257,130491-130728,130833-131236, 131284-131427,131709-131995,132071-132150,132563-132714, 132793-132909,133292-133450,133546-133946,134106-134423, 135050-135095,135203-135310 Length = 932 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 214 GELITNVVNNLIRKTR*TAWXTPTSSGCXAPRXSSGIVS 330 GE++TN ++ L TR TA+ PT++ P G+ S Sbjct: 109 GEILTNPISRLGLSTRETAFVEPTTADQHVPGYGKGLSS 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,294,205 Number of Sequences: 37544 Number of extensions: 164779 Number of successful extensions: 381 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -