BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0917 (480 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 3.9 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 6.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.9 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 3.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 270 CSSSCFSYQIVYDICDEL 217 CS +Y+I D+CD L Sbjct: 116 CSGITSAYKIEIDMCDRL 133 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.0 bits (42), Expect = 6.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -3 Query: 82 RKDTGQQQRTSSSERRLLWFTRPR 11 R TG ++ ++ +R W++RPR Sbjct: 27 RPITGDEKWVVNNIKRKRWWSRPR 50 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 1 GIRHEAW*TKEAGAPKMKSAVVVLCLFAASLY 96 G HE T A + + V ++CL++ +Y Sbjct: 730 GNAHETQITTLCVAISLSATVTLVCLYSPKIY 761 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 1 GIRHEAW*TKEAGAPKMKSAVVVLCLFAASLY 96 G HE T A + + V ++CL++ +Y Sbjct: 820 GNAHETQITTLCVAISLSATVTLVCLYSPKIY 851 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,092 Number of Sequences: 438 Number of extensions: 1578 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -