BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0913 (505 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC091490-1|AAH91490.1| 620|Homo sapiens ODF2L protein protein. 29 9.2 AL136382-2|CAI23514.1| 636|Homo sapiens novel protein protein. 29 9.2 >BC091490-1|AAH91490.1| 620|Homo sapiens ODF2L protein protein. Length = 620 Score = 29.1 bits (62), Expect = 9.2 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +1 Query: 265 HMRNSCDGMFVRLVHFQFQNETIKRTNAPVRSVVYVILYVPCAILKFYSLKRIIIFHMV 441 H +NSC+ + ++ +++NET+ N ++ L PC I + ++ +I+ M+ Sbjct: 322 HGKNSCEEILRKVHSIEYENETLNLENTKLK------LRFPCRITESKNMNILIVLDML 374 >AL136382-2|CAI23514.1| 636|Homo sapiens novel protein protein. Length = 636 Score = 29.1 bits (62), Expect = 9.2 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +1 Query: 265 HMRNSCDGMFVRLVHFQFQNETIKRTNAPVRSVVYVILYVPCAILKFYSLKRIIIFHMV 441 H +NSC+ + ++ +++NET+ N ++ L PC I + ++ +I+ M+ Sbjct: 322 HGKNSCEEILRKVHSIEYENETLNLENTKLK------LRFPCRITESKNMNILIVLDML 374 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,318,018 Number of Sequences: 237096 Number of extensions: 941073 Number of successful extensions: 1512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1512 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4649883964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -