BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0913 (505 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084197-4|AAO38575.1| 335|Caenorhabditis elegans Serpentine re... 29 2.5 AC024753-1|AAF60456.1| 732|Caenorhabditis elegans Hypothetical ... 27 5.8 >AC084197-4|AAO38575.1| 335|Caenorhabditis elegans Serpentine receptor, class v protein27 protein. Length = 335 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 292 FVRLVHFQFQNETIKRTNAPVRSVVYVILYVPCAILKFYSLKRIII 429 F+R +F +Q I A +++YV LY+ C + SL+R ++ Sbjct: 76 FIRQFYFDYQEYYIA---AATYNIIYVSLYIRCTGIILLSLQRYLV 118 >AC024753-1|AAF60456.1| 732|Caenorhabditis elegans Hypothetical protein Y23H5B.6 protein. Length = 732 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 155 EHMKNFKISRTKKFMRPITKVSSSPQCIYVKL 60 E + N IS+TK + +TKVS++ + + KL Sbjct: 579 EKISNITISKTKPLKKAVTKVSAAKKILNKKL 610 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,904,182 Number of Sequences: 27780 Number of extensions: 175330 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -