BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0907 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27210.1 68414.m03314 expressed protein 33 0.26 At5g48380.1 68418.m05978 leucine-rich repeat family protein / pr... 28 5.6 At5g62660.1 68418.m07864 F-box family protein contains Pfam prof... 28 7.4 At3g54400.1 68416.m06015 aspartyl protease family protein contai... 28 7.4 At4g13660.1 68417.m02124 pinoresinol-lariciresinol reductase, pu... 27 9.8 At3g03950.2 68416.m00414 expressed protein contains Pfam profile... 27 9.8 At3g03950.1 68416.m00413 expressed protein contains Pfam profile... 27 9.8 >At1g27210.1 68414.m03314 expressed protein Length = 625 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 632 SLDMICAKGRPPRFDSACNGDSCSXL 709 S D+ + GR PR S C GDSCS L Sbjct: 524 SCDLAVSNGRVPRNSSGCAGDSCSKL 549 >At5g48380.1 68418.m05978 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 620 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 616 IRAIQLSGYDLR*RSPPTVRLC 681 + +I+LSGY LR PP V+LC Sbjct: 78 VLSIKLSGYGLRGVFPPAVKLC 99 >At5g62660.1 68418.m07864 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 379 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 103 IFVLNPVCHWRRVEVARTHLP 41 +FVL P W+R+E + HLP Sbjct: 221 VFVLEPGGSWKRIEFDQPHLP 241 >At3g54400.1 68416.m06015 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 425 Score = 27.9 bits (59), Expect = 7.4 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -3 Query: 284 STGQYVMTVRNSVQCPAVRIHF-GL-IMEPPQVPPKRTACGNLSCTAFTSDCVFVNSVV 114 S G + SV P+V F G+ + PP ++ GNLSC A + V VNSV+ Sbjct: 337 SLGGFDTCYSGSVVFPSVTFMFAGMNVTLPPDNLLIHSSAGNLSCLAMAAAPVNVNSVL 395 >At4g13660.1 68417.m02124 pinoresinol-lariciresinol reductase, putative similar to pinoresinol-lariciresinol reductase TH1 [Tsuga heterophylla][GI:7578915]; contains isoflavone reductase domain PF02716 Length = 317 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 583 LHGVHIFTHHAPMLVSSVASISDVDPIGRF 494 + GVH TH+ P+ + VA+I + + RF Sbjct: 89 MSGVHFRTHNIPVQLKLVAAIKEAGNVKRF 118 >At3g03950.2 68416.m00414 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 424 Score = 27.5 bits (58), Expect = 9.8 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +2 Query: 518 GYAGYGTDEHGGVMRKDMHAMELSTQSDEVCSKLEQYNSLDMICAKGRPPRF--DSACNG 691 G+A YG HG R +M+A L D + S Y + PRF D N Sbjct: 45 GHAPYGASSHGSERRPNMNAGNLLNGGDSIGSYPWGYIPANYPSGGYPDPRFGYDRNSNH 104 Query: 692 DSCSXLVD 715 S S L++ Sbjct: 105 SSFSHLMN 112 >At3g03950.1 68416.m00413 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 425 Score = 27.5 bits (58), Expect = 9.8 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +2 Query: 518 GYAGYGTDEHGGVMRKDMHAMELSTQSDEVCSKLEQYNSLDMICAKGRPPRF--DSACNG 691 G+A YG HG R +M+A L D + S Y + PRF D N Sbjct: 46 GHAPYGASSHGSERRPNMNAGNLLNGGDSIGSYPWGYIPANYPSGGYPDPRFGYDRNSNH 105 Query: 692 DSCSXLVD 715 S S L++ Sbjct: 106 SSFSHLMN 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,800,009 Number of Sequences: 28952 Number of extensions: 356774 Number of successful extensions: 829 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -