BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0906 (274 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 0.89 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 1.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 2.7 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 22 4.7 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 0.89 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 64 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 165 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 263 IVLWGSSPPGSWRHLR*XXRCL*TQHKTEWSCC 165 IV+WG PPG + R + ++ +CC Sbjct: 329 IVVWGKRPPGEAENSRDQRMAKSKRKFSQQNCC 361 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 114 QEYVVPRSIPTAGAFA 67 Q+Y PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 21.8 bits (44), Expect = 4.7 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 214 EXLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGCFCH 65 + LG E+ RS PVA V ++ D ++ V G+ + G F H Sbjct: 72 QALGQLEK--ARSKPVAFAVRTNVSYDGSLDDDSPVHGSAVSFEVGDFLH 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 323,590 Number of Sequences: 2352 Number of extensions: 6546 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15730956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -